Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-FIZ1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Small Intestine)

Rabbit FIZ1 Polyclonal Antibody | anti-FIZ1 antibody

FIZ1 antibody - middle region

Gene Names
FIZ1; ZNF798
Reactivity
Cow, Dog, Human, Mouse, Pig, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
FIZ1; Polyclonal Antibody; FIZ1 antibody - middle region; anti-FIZ1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Human, Mouse, Pig, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LAAHWAAHTDVKPFKCPRCERDFNAPALLERHKLTHDLQGPGAPPAQAWA
Sequence Length
496
Applicable Applications for anti-FIZ1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 86%; Human: 100%; Mouse: 79%; Pig: 100%; Rat: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human FIZ1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-FIZ1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Small Intestine)

Western Blot (WB) (WB Suggested Anti-FIZ1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Small Intestine)
Related Product Information for anti-FIZ1 antibody
This is a rabbit polyclonal antibody against FIZ1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: FIZ1 is zinc finger protein, which interacts with a receptor tyrosine kinase involved in the regulation of hematopoietic and lymphoid cells. FIZ1 also interacts with a transcription factor that regulates the expression of rod-specific genes in retina.
Product Categories/Family for anti-FIZ1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
52kDa
NCBI Official Full Name
flt3-interacting zinc finger protein 1
NCBI Official Synonym Full Names
FLT3 interacting zinc finger 1
NCBI Official Symbol
FIZ1
NCBI Official Synonym Symbols
ZNF798
NCBI Protein Information
flt3-interacting zinc finger protein 1
UniProt Protein Name
Flt3-interacting zinc finger protein 1
UniProt Gene Name
FIZ1
UniProt Synonym Gene Names
ZNF798
UniProt Entry Name
FIZ1_HUMAN

NCBI Description

This gene encodes zinc finger protein, which interacts with a receptor tyrosine kinase involved in the regulation of hematopoietic and lymphoid cells. This gene product also interacts with a transcription factor that regulates the expression of rod-specific genes in retina. [provided by RefSeq, Jul 2008]

Uniprot Description

Function: May be a transcriptional repressor of NRL function in photoreceptors. Does not repress CRX-mediated transactivation

By similarity.

Subunit structure: Interacts with FLT3 cytoplasmic catalytic domain, following receptor stimulation, in a kinase-independent manner. Does not interact with other structurally related receptor tyrosine kinases, including KIT, CSF1R and PDGFR. Interacts with NRL

By similarity.

Subcellular location: Cytoplasm

By similarity. Nucleus

By similarity.

Tissue specificity: Widely expressed. Ref.5

Sequence similarities: Contains 11 C2H2-type zinc fingers.

Sequence caution: The sequence BAD18728.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.

Research Articles on FIZ1

Similar Products

Product Notes

The FIZ1 fiz1 (Catalog #AAA3200126) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FIZ1 antibody - middle region reacts with Cow, Dog, Human, Mouse, Pig, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's FIZ1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the FIZ1 fiz1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LAAHWAAHTD VKPFKCPRCE RDFNAPALLE RHKLTHDLQG PGAPPAQAWA. It is sometimes possible for the material contained within the vial of "FIZ1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.