Rabbit anti-Human FBXO6 Polyclonal Antibody | anti-FBXO6 antibody

FBXO6 (F-box Only Protein 6, F-Box/G-domain Protein 2, F-box Protein That Recognizes Sugar Chains 2, FBG 2, FBG2, FBX 6, FBX6) (Biotin)

Cat. Num. AAA6378308

• Gene Names: FBXO6; FBG2; FBS2; FBX6; Fbx6b
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: FBXO6; Polyclonal Antibody; FBXO6 (F-box Only Protein 6; F-Box/G-domain Protein 2; F-box Protein That Recognizes Sugar Chains 2; FBG 2; FBG2; FBX 6; FBX6) (Biotin); anti-FBXO6 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human FBXO6.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-FBXO6 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human FBXO6, aa1-293 (NP_060908.1).
• Immunogen Sequence: MDAPHSKAALDSINELPENILLELFTHVPARQLLLNCRLVCSLWRDLIDLMTLWKRKCLREGFITKDWDQPVADWKIFYFLRSLHRNLLRNPCAEEDMFAWQIDFNGGDRWKVESLPGAHGTDFPDPKVKKYFVTSYEMCLKSQLVDLVAEGYWEELLDTFRPDIVVKDWFAARADCGCTYQLKVQLASADYFVLASFEPPPVTIQQWNNATWTEVSYTFSDYPRGVRYILFQHGGRDTQYWAGWYGPRVTNSSIVVSPKMTRNQASSEAQPGQKHGQEEAAQSPYRAVVQIF
• Conjugate: Biotin
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(FBXO6 rabbit polyclonal antibody. Western Blot analysis of FBXO6 expression in human kidney.)

Western Blot (WB)

(FBXO6 rabbit polyclonal antibody. Western Blot analysis of FBXO6 expression in HepG2.)

Western Blot (WB)

(Western Blot analysis of FBXO6 expression in transfected 293T cell line by FBXO6 polyclonal antibody. Lane 1: FBXO6 transfected lysate (33.9kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-FBXO6 antibody

Substrate-recognition component of some SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complexes. Involved in endoplasmic reticulum-associated degradation pathway (ERAD) for misfolded lumenal proteins by recognizing and binding sugar chains on unfolded glycoproteins that are retrotranlocated into the cytosol and promoting their ubiquitination and subsequent degradation. Able to recognize and bind denatured glycoproteins, which are modified with not only high-mannose but also complex-type oligosaccharides. Also recognizes sulfated glycans. Also involved in DNA damage response by specifically recognizing activated CHEK1 (phosphorylated on 'Ser-345'), promoting its ubiquitination and degradation. Ubiquitination of CHEK1 is required to insure that activated CHEK1 does not accumulate as cells progress through S phase, or when replication forks encounter transient impediments during normal DNA replication.

Product Categories/Family for anti-FBXO6 antibody

Antibodies; Ubiquitin Ligases

NCBI and Uniprot Product Information

• NCBI GI #: 8922188
• NCBI GeneID: 26270
• NCBI Accession #: NP_060908.1
• NCBI GenBank Nucleotide #: NM_018438.4
• UniProt Accession #: Q9NRD1; Q9UKT3; B1AK42; B2RC88
• Molecular Weight: 33,933 Da
• NCBI Official Full Name: F-box only protein 6
• NCBI Official Synonym Full Names: F-box protein 6
• NCBI Official Symbol: FBXO6
• NCBI Official Synonym Symbols: FBG2; FBS2; FBX6; Fbx6b
• NCBI Protein Information: F-box only protein 6; F-box protein FBG2; F-box protein Fbx6; F-box protein that recognizes sugar chains 2; F-box/G-domain protein 2
• UniProt Protein Name: F-box only protein 6
• UniProt Gene Name: FBXO6
• UniProt Synonym Gene Names: FBG2; FBS2; FBX6
• UniProt Entry Name: FBX6_HUMAN

NCBI Description

This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbxs class, and its C-terminal region is highly similar to that of rat NFB42 (neural F Box 42 kDa) which may be involved in the control of the cell cycle. [provided by RefSeq, Jul 2008]

Uniprot Description

FBXO6: Substrate-recognition component of some SCF (SKP1-CUL1- F-box protein)-type E3 ubiquitin ligase complexes. Involved in endoplasmic reticulum-associated degradation pathway (ERAD) for misfolded lumenal proteins by recognizing and binding sugar chains on unfolded glycoproteins that are retrotranlocated into the cytosol and promoting their ubiquitination and subsequent degradation. Able to recognize and bind denatured glycoproteins, which are modified with not only high-mannose but also complex- type oligosaccharides. Also recognizes sulfated glycans. Also involved in DNA damage response by specifically recognizing activated CHEK1 (phosphorylated on 'Ser-345'), promoting its ubiquitination and degradation. Ubiquitination of CHEK1 is required to insure that activated CHEK1 does not accumulate as cells progress through S phase, or when replication forks encounter transient impediments during normal DNA replication.

Protein type: Ubiquitin conjugating system

Chromosomal Location of Human Ortholog: 1p36.22

Cellular Component: cytoplasm; SCF ubiquitin ligase complex

Molecular Function: protein binding; ubiquitin-protein ligase activity; carbohydrate binding; glycoprotein binding

Biological Process: SCF-dependent proteasomal ubiquitin-dependent protein catabolic process; ER-associated protein catabolic process; DNA damage checkpoint; protein ubiquitination; glycoprotein catabolic process; proteolysis; DNA repair; response to unfolded protein