Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (FBXO6 rabbit polyclonal antibody. Western Blot analysis of FBXO6 expression in human kidney.)

Rabbit anti-Human FBXO6 Polyclonal Antibody | anti-FBXO6 antibody

FBXO6 (F-box Only Protein 6, F-Box/G-domain Protein 2, F-box Protein That Recognizes Sugar Chains 2, FBG 2, FBG2, FBX 6, FBX6) (FITC)

Gene Names
FBXO6; FBG2; FBS2; FBX6; Fbx6b
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
FBXO6; Polyclonal Antibody; FBXO6 (F-box Only Protein 6; F-Box/G-domain Protein 2; F-box Protein That Recognizes Sugar Chains 2; FBG 2; FBG2; FBX 6; FBX6) (FITC); anti-FBXO6 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human FBXO6.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein Isothiocyanate (FITC).
Applicable Applications for anti-FBXO6 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human FBXO6, aa1-293 (NP_060908.1).
Immunogen Sequence
MDAPHSKAALDSINELPENILLELFTHVPARQLLLNCRLVCSLWRDLIDLMTLWKRKCLREGFITKDWDQPVADWKIFYFLRSLHRNLLRNPCAEEDMFAWQIDFNGGDRWKVESLPGAHGTDFPDPKVKKYFVTSYEMCLKSQLVDLVAEGYWEELLDTFRPDIVVKDWFAARADCGCTYQLKVQLASADYFVLASFEPPPVTIQQWNNATWTEVSYTFSDYPRGVRYILFQHGGRDTQYWAGWYGPRVTNSSIVVSPKMTRNQASSEAQPGQKHGQEEAAQSPYRAVVQIF
Conjugate
FITC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(FBXO6 rabbit polyclonal antibody. Western Blot analysis of FBXO6 expression in human kidney.)

Western Blot (WB) (FBXO6 rabbit polyclonal antibody. Western Blot analysis of FBXO6 expression in human kidney.)

Western Blot (WB)

(FBXO6 rabbit polyclonal antibody. Western Blot analysis of FBXO6 expression in HepG2.)

Western Blot (WB) (FBXO6 rabbit polyclonal antibody. Western Blot analysis of FBXO6 expression in HepG2.)

Western Blot (WB)

(Western Blot analysis of FBXO6 expression in transfected 293T cell line by FBXO6 polyclonal antibody. Lane 1: FBXO6 transfected lysate (33.9kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of FBXO6 expression in transfected 293T cell line by FBXO6 polyclonal antibody. Lane 1: FBXO6 transfected lysate (33.9kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-FBXO6 antibody
Substrate-recognition component of some SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complexes. Involved in endoplasmic reticulum-associated degradation pathway (ERAD) for misfolded lumenal proteins by recognizing and binding sugar chains on unfolded glycoproteins that are retrotranlocated into the cytosol and promoting their ubiquitination and subsequent degradation. Able to recognize and bind denatured glycoproteins, which are modified with not only high-mannose but also complex-type oligosaccharides. Also recognizes sulfated glycans. Also involved in DNA damage response by specifically recognizing activated CHEK1 (phosphorylated on 'Ser-345'), promoting its ubiquitination and degradation. Ubiquitination of CHEK1 is required to insure that activated CHEK1 does not accumulate as cells progress through S phase, or when replication forks encounter transient impediments during normal DNA replication.
Product Categories/Family for anti-FBXO6 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33,933 Da
NCBI Official Full Name
F-box only protein 6
NCBI Official Synonym Full Names
F-box protein 6
NCBI Official Symbol
FBXO6
NCBI Official Synonym Symbols
FBG2; FBS2; FBX6; Fbx6b
NCBI Protein Information
F-box only protein 6; F-box protein FBG2; F-box protein Fbx6; F-box protein that recognizes sugar chains 2; F-box/G-domain protein 2
UniProt Protein Name
F-box only protein 6
UniProt Gene Name
FBXO6
UniProt Synonym Gene Names
FBG2; FBS2; FBX6
UniProt Entry Name
FBX6_HUMAN

NCBI Description

This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbxs class, and its C-terminal region is highly similar to that of rat NFB42 (neural F Box 42 kDa) which may be involved in the control of the cell cycle. [provided by RefSeq, Jul 2008]

Uniprot Description

FBXO6: Substrate-recognition component of some SCF (SKP1-CUL1- F-box protein)-type E3 ubiquitin ligase complexes. Involved in endoplasmic reticulum-associated degradation pathway (ERAD) for misfolded lumenal proteins by recognizing and binding sugar chains on unfolded glycoproteins that are retrotranlocated into the cytosol and promoting their ubiquitination and subsequent degradation. Able to recognize and bind denatured glycoproteins, which are modified with not only high-mannose but also complex- type oligosaccharides. Also recognizes sulfated glycans. Also involved in DNA damage response by specifically recognizing activated CHEK1 (phosphorylated on 'Ser-345'), promoting its ubiquitination and degradation. Ubiquitination of CHEK1 is required to insure that activated CHEK1 does not accumulate as cells progress through S phase, or when replication forks encounter transient impediments during normal DNA replication.

Protein type: Ubiquitin conjugating system

Chromosomal Location of Human Ortholog: 1p36.22

Cellular Component: cytoplasm; SCF ubiquitin ligase complex

Molecular Function: protein binding; ubiquitin-protein ligase activity; carbohydrate binding; glycoprotein binding

Biological Process: SCF-dependent proteasomal ubiquitin-dependent protein catabolic process; ER-associated protein catabolic process; DNA damage checkpoint; protein ubiquitination; glycoprotein catabolic process; proteolysis; DNA repair; response to unfolded protein

Research Articles on FBXO6

Similar Products

Product Notes

The FBXO6 fbxo6 (Catalog #AAA6378309) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FBXO6 (F-box Only Protein 6, F-Box/G-domain Protein 2, F-box Protein That Recognizes Sugar Chains 2, FBG 2, FBG2, FBX 6, FBX6) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FBXO6 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the FBXO6 fbxo6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "FBXO6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.