Rabbit anti-Human FBXL8 Polyclonal Antibody | anti-FBXL8 antibody

FBXL8 (FBL8, F-box/LRR-repeat Protein 8, F-box and Leucine-rich Repeat Protein 8, F-box Protein FBL8, FLJ11278, MGC19959)

Cat. Num. AAA6008964

• Reactivity: Human
• Applications: Immunoprecipitation
• Purity: Serum; Serum
• Synonyms: FBXL8; Polyclonal Antibody; FBXL8 (FBL8; F-box/LRR-repeat Protein 8; F-box and Leucine-rich Repeat Protein 8; F-box Protein FBL8; FLJ11278; MGC19959); Anti -FBXL8 (FBL8; anti-FBXL8 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human FBXL8.
• Purity/Purification: Serum; Serum
• Form/Format: Supplied as a liquid.
• Sequence: MAEPGEGLPEEVLALIFRHLSLRDRAAAARVCRAWAAAATCSAVWHDTKISCECELEGMLPPYLSACLDHIHNLRLEFEPSRKPSRRAAIELLMVLAGRAPGLRGLRLECRGEKPLFDAGRDVLEAVHAVCGAASQLRHLDLRRLSFTLDDALVLQAARSCPELHSLFLDNSTLVGSVGPGSVLELLEACPRLRALGLHLASLSHAILEALAAPDRAPFALLALRCACPEDARASPLPNEAWVALRRRHPGLAVELELEPALPAESVTRVLQPAVPVAALRLNLSGDTVGPVRFAAHHYAATLCALEVRAAASAELNAALEELAARCAALREVHCFCVVSHSVLDAFRAHCPRLRTYTLKLTREPHPWRPTLVA

• Applicable Applications for anti-FBXL8 antibody: Immunoprecipitation (IP)
• Application Notes: Suitable for use in Immunoprecipitation.
• Immunogen: Full length human FBXL8, aa1-374 (NP_060848.2).
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Immunoprecipitation (IP)

(Immunoprecipitation of FBXL8 transfected lysate using FBXL8 rabbit polyclonal antibody and Protein A Magnetic Bead and immunoblotted with FBXL8 purified mouse polyclonal antibody.)

Related Product Information for anti-FBXL8 antibody

This gene encodes a member of the F-box protein family which is characterized by an approximately 40aa motif, the F-box. The F-box proteins constitute one of the 4 subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbls class. It shares 78% sequence identity with the mouse protein.

Product Categories/Family for anti-FBXL8 antibody

Antibodies; Abs to Ubiquitin Ligases

NCBI and Uniprot Product Information

• NCBI GI #: 116004091
• NCBI GeneID: 614765
• NCBI Accession #: NP_001070405.1
• NCBI GenBank Nucleotide #: NM_001076937.1
• UniProt Accession #: Q08DG4
• Molecular Weight: 40,594 Da
• NCBI Official Full Name: F-box/LRR-repeat protein 8
• NCBI Official Synonym Full Names: F-box and leucine-rich repeat protein 8<
• NCBI Official Symbol: FBXL8
• NCBI Protein Information: F-box/LRR-repeat protein 8
• UniProt Protein Name: F-box/LRR-repeat protein 8
• Protein Family: F-box/LRR-repeat protein
• UniProt Gene Name: FBXL8
• UniProt Entry Name: FBXL8_BOVIN

Uniprot Description

Function: Substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex

By similarity.

Subunit structure: Directly interacts with SKP1 and CUL1

By similarity.

Sequence similarities: Contains 1 F-box domain.

Caution: While the gene symbol and protein names are indicative of the presence of LRR repeats, such repeats are not present in this protein.