Western Blot (WB)
(Host: RabbitTarget Name: FASTKSample Tissue: Human DLD1 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Rabbit anti-Human FASTK Polyclonal Antibody | anti-FASTK antibody
FASTK Antibody - N-terminal region
Gene Names
FASTK; FAST
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
FASTK; Polyclonal Antibody; FASTK Antibody - N-terminal region; anti-FASTK antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 29% sucrose.
Sequence
Synthetic peptide located within the following region: SPSPNSMLRVLLSAQTSPARLSGLLLIPPVQPCCLGPSKWGDRPVGGGPS
Sequence Length
522
Applicable Applications for anti-FASTK antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human FASTK
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: FASTKSample Tissue: Human DLD1 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: FASTKSample Tissue: Human DLD1 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-FASTK antibody
The protein encoded by this gene is a member of the serine/threonine protein kinase family. This kinase was shown to be activated rapidly during Fas-mediated apoptosis in Jurkat cells. In response to Fas receptor ligation, it phosphorylates TIA1, an apoptosis-promoting nuclear RNA-binding protein. The encoded protein is a strong inducer of lymphocyte apoptosis. Two transcript variants encoding different isoforms have been found for this gene. Other variants exist, but their full-length natures have not yet been determined.
Product Categories/Family for anti-FASTK antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
57 kDa
NCBI Official Full Name
fas-activated serine/threonine kinase isoform 5
NCBI Official Synonym Full Names
Fas activated serine/threonine kinase
NCBI Official Symbol
FASTK
NCBI Official Synonym Symbols
FAST
NCBI Protein Information
fas-activated serine/threonine kinase
UniProt Protein Name
Fas-activated serine/threonine kinase
Protein Family
UniProt Gene Name
FASTK
UniProt Synonym Gene Names
FAST kinase
UniProt Entry Name
FASTK_HUMAN
NCBI Description
The protein encoded by this gene is a member of the serine/threonine protein kinase family. This kinase was shown to be activated rapidly during Fas-mediated apoptosis in Jurkat cells. In response to Fas receptor ligation, it phosphorylates TIA1, an apoptosis-promoting nuclear RNA-binding protein. The encoded protein is a strong inducer of lymphocyte apoptosis. Two transcript variants encoding different isoforms have been found for this gene. Other variants exist, but their full-length natures have not yet been determined. [provided by RefSeq, Jul 2008]
Research Articles on FASTK
Similar Products
Product Notes
The FASTK fastk (Catalog #AAA3221127) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FASTK Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FASTK can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the FASTK fastk for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SPSPNSMLRV LLSAQTSPAR LSGLLLIPPV QPCCLGPSKW GDRPVGGGPS. It is sometimes possible for the material contained within the vial of "FASTK, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
