Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (FAM82C antibody (MBS839549) used at 1 ug/ml to detect target protein.)

Rabbit FAM82C Polyclonal Antibody | anti-FAM82C antibody

FAM82C antibody

Gene Names
RMDN3; RMD3; RMD-3; FAM82C; FAM82A2; ptpip51
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity purified
Synonyms
FAM82C; Polyclonal Antibody; FAM82C antibody; Polyclonal FAM82C; Anti-FAM82C; FAM-82; ptpip51; FAM 82; Family With Sequence Similarity 82 Member C; FAM82; FLJ10579; anti-FAM82C antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Specificity
FAM82C antibody was raised against the middle region of Fam82C
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FAM82C antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
470
Applicable Applications for anti-FAM82C antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
FAM82C may participate in differentiation and apoptosis of keratinocytes. Overexpression of FAM82C protein induces apoptosis.
Cross-Reactivity
Human,Mouse,Rat
Immunogen
FAM82C antibody was raised using the middle region of Fam82C corresponding to a region with amino acids LSATVEDALQSFLKAEELQPGFSKAGRVYISKCYRELGKNSEARWWMKLA
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(FAM82C antibody (MBS839549) used at 1 ug/ml to detect target protein.)

Western Blot (WB) (FAM82C antibody (MBS839549) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-FAM82C antibody
Rabbit polyclonal FAM82C antibody raised against the middle region of Fam82C
Product Categories/Family for anti-FAM82C antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
52 kDa (MW of target protein)
NCBI Official Full Name
family with sequence similarity 82, member C, isoform CRA_a
NCBI Official Synonym Full Names
regulator of microtubule dynamics 3
NCBI Official Symbol
RMDN3
NCBI Official Synonym Symbols
RMD3; RMD-3; FAM82C; FAM82A2; ptpip51
NCBI Protein Information
regulator of microtubule dynamics protein 3
UniProt Protein Name
Regulator of microtubule dynamics protein 3
UniProt Gene Name
RMDN3
UniProt Synonym Gene Names
FAM82A2; FAM82C; PTPIP51; RMD-3; hRMD-3
UniProt Entry Name
RMD3_HUMAN

Uniprot Description

FAM82A2: a single-pass membrane protein in the mitochondrial membrane. May participate in differentiation and apoptosis of keratinocytes. Overexpression induces apoptosis. Present at high level in epidermis and seminiferous epithelium: while basal cells in the epidermis and spermatogonia show no perceptible amount, keratinocytes of suprabasal layers and differentiating first-order spermatocytes up to spermatids exhibit high expression. In skeletal muscle, its presence is restricted to fibers of the fast twitch type. In surface epithelia containing ciliated cells, it is associated with the microtubular structures responsible for ciliary movement. Also present in specific structures of the central nervous system such as neurons of the hippocampal region, ganglion cells of the autonomic nervous system, and axons of the peripheral nervous system. Induced by EGF, TGF-beta, retinoic acid-and 1,25-Dihydroxyvitamin D(3). Two alternatively spliced human isoforms may be produced.

Protein type: Apoptosis; Membrane protein, integral; Mitochondrial

Chromosomal Location of Human Ortholog: 15q15.1

Cellular Component: spindle pole; microtubule; mitochondrial outer membrane; mitochondrion; integral to membrane; nucleus

Molecular Function: protein binding

Biological Process: cellular calcium ion homeostasis; apoptosis; cell differentiation

Research Articles on FAM82C

Similar Products

Product Notes

The FAM82C rmdn3 (Catalog #AAA839549) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FAM82C antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's FAM82C can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the FAM82C rmdn3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "FAM82C, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.