Western Blot (WB)
(WB Suggested Anti-ZNF189 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: HepG2 cell lysateZNF189 is supported by BioGPS gene expression data to be expressed in HepG2)
Rabbit ZNF189 Polyclonal Antibody | anti-ZNF189 antibody
ZNF189 antibody - N-terminal region
Reactivity
Cow, Dog, Horse, Human, Pig, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ZNF189; Polyclonal Antibody; ZNF189 antibody - N-terminal region; anti-ZNF189 antibody
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Pig, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GLLTFEDVAVFFTQEEWDYLDPAQRSLYKDVMMENYGNLVSLDVLNRDKD
Sequence Length
626
Applicable Applications for anti-ZNF189 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Pig: 92%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF189
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-ZNF189 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: HepG2 cell lysateZNF189 is supported by BioGPS gene expression data to be expressed in HepG2)
Western Blot (WB)
(WB Suggested Anti-ZNF189 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: HepG2 cell lysateZNF189 is supported by BioGPS gene expression data to be expressed in HepG2)
Related Product Information for anti-ZNF189 antibody
This is a rabbit polyclonal antibody against ZNF189. It was validated on Western Blot
Target Description: ZNF189 may be involved in transcriptional regulation.
Target Description: ZNF189 may be involved in transcriptional regulation.
Product Categories/Family for anti-ZNF189 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
73kDa
NCBI Official Full Name
zinc finger protein 189 isoform 1
NCBI Official Synonym Full Names
zinc finger protein 189
NCBI Official Symbol
ZNF189
NCBI Protein Information
zinc finger protein 189
UniProt Protein Name
Zinc finger protein 189
Protein Family
UniProt Gene Name
ZNF189
UniProt Entry Name
ZN189_HUMAN
NCBI Description
Kruppel-like zinc finger proteins such as ZNF189 contain a conserved stretch of 7 amino acids that connects a variable number of DNA-binding zinc finger repeats of the cys(2)his(2) (C2H2) type (summarized by Odeberg et al., 1998 [PubMed 9653648]). Approximately 30% of human Kruppel-like zinc finger proteins contain an N-terminal Kruppel-associated box (KRAB) domain. The KRAB domain consists of approximately 75 amino acids that may be subdivided into an A box, which is present in every KRAB domain and is essential for transcriptional repression, and a B box, which is not always present.[supplied by OMIM, May 2010]
Research Articles on ZNF189
Similar Products
Product Notes
The ZNF189 znf189 (Catalog #AAA3204031) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ZNF189 antibody - N-terminal region reacts with Cow, Dog, Horse, Human, Pig, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ZNF189 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ZNF189 znf189 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GLLTFEDVAV FFTQEEWDYL DPAQRSLYKD VMMENYGNLV SLDVLNRDKD. It is sometimes possible for the material contained within the vial of "ZNF189, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
