Rabbit FAM62C Polyclonal Antibody | anti-FAM62C antibody

FAM62C antibody

Cat. Num. AAA5300584

• Reactivity: Human, Mouse, Rat
• Applications: Western Blot
• Purity: Affinity purified
• Synonyms: FAM62C; Polyclonal Antibody; FAM62C antibody; Polyclonal FAM62C; Anti-FAM62C; FAM 62; C2 Domain Containing Member C; Family With Sequence Similarity 62; FAM62; CHR3SYT; FAM-62; anti-FAM62C antibody

• Host: Rabbit
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Purity/Purification: Affinity purified
• Form/Format: Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FAM62C antibody in PBS
• Concentration: 1 mg/ml (varies by lot)
• Sequence Length: 44

• Applicable Applications for anti-FAM62C antibody: Western Blot (WB)
• Application Notes: WB: 1 ug/ml
• Biological Significance: FAM62C belongs to the extended synaptotagmin family. It is a single-pass membrane protein, and contains 3 C2 domains. FAM62C may play a role as calcium-regulated intrinsic membrane protein.
• Cross-Reactivity: Human,Mouse,Rat
• Immunogen: FAM62C antibody was raised using a synthetic peptide corresponding to a region with amino acids RNRRGKLGRLAAAFEFLDNEREFISRELRGQHLPAWIHFPDVERVEWANK
• Preparation and Storage: Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(FAM62C antibody (MBS5300584) used at 1 ug/ml to detect target protein.)

Related Product Information for anti-FAM62C antibody

Rabbit polyclonal FAM62C antibody

Product Categories/Family for anti-FAM62C antibody

Cell Biology; Purified Polyclonal Antibodies

NCBI and Uniprot Product Information

• NCBI GI #: 13276577
• UniProt Accession #: A0FGR9; Q6ZV21; Q8NDZ5; Q9BQR9; A8K0G5
• Molecular Weight: 100 kDa (MW of target protein)
• NCBI Official Full Name: FAM62C, partial
• UniProt Protein Name: Extended synaptotagmin-3
• UniProt Gene Name: ESYT3
• UniProt Synonym Gene Names: FAM62C; E-Syt3
• UniProt Entry Name: ESYT3_HUMAN

Uniprot Description

ESYT3: May play a role as calcium-regulated intrinsic membrane protein. Belongs to the extended synaptotagmin family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 3q22.3

Cellular Component: intrinsic to endoplasmic reticulum membrane; extrinsic to internal side of plasma membrane; integral to plasma membrane

Molecular Function: protein binding; metal ion binding; phospholipid binding

Biological Process: lipid transport