Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Rabbit FAM62C Polyclonal Antibody | anti-FAM62C antibody

FAM62C antibody

Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity purified
Synonyms
FAM62C; Polyclonal Antibody; FAM62C antibody; Polyclonal FAM62C; Anti-FAM62C; FAM 62; C2 Domain Containing Member C; Family With Sequence Similarity 62; FAM62; CHR3SYT; FAM-62; anti-FAM62C antibody
Ordering
 
When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures.
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FAM62C antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
44
Applicable Applications for anti-FAM62C antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
FAM62C belongs to the extended synaptotagmin family. It is a single-pass membrane protein, and contains 3 C2 domains. FAM62C may play a role as calcium-regulated intrinsic membrane protein.
Cross-Reactivity
Human,Mouse,Rat
Immunogen
FAM62C antibody was raised using a synthetic peptide corresponding to a region with amino acids RNRRGKLGRLAAAFEFLDNEREFISRELRGQHLPAWIHFPDVERVEWANK
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(FAM62C antibody (MBS5300584) used at 1 ug/ml to detect target protein.)

Related Product Information for anti-FAM62C antibody
Rabbit polyclonal FAM62C antibody
Product Categories/Family for anti-FAM62C antibody

NCBI and Uniprot Product Information

NCBI GI #
UniProt Accession #
Molecular Weight
100 kDa (MW of target protein)
NCBI Official Full Name
FAM62C, partial
UniProt Protein Name
Extended synaptotagmin-3
UniProt Gene Name
ESYT3
UniProt Synonym Gene Names
FAM62C; E-Syt3
UniProt Entry Name
ESYT3_HUMAN

Uniprot Description

ESYT3: May play a role as calcium-regulated intrinsic membrane protein. Belongs to the extended synaptotagmin family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 3q22.3

Cellular Component: intrinsic to endoplasmic reticulum membrane; extrinsic to internal side of plasma membrane; integral to plasma membrane

Molecular Function: protein binding; metal ion binding; phospholipid binding

Biological Process: lipid transport

Similar Products

Product Notes

The FAM62C esyt3 (Catalog #AAA5300584) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FAM62C antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's FAM62C can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the FAM62C esyt3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "FAM62C, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.
Looking for a specific manual?
Request a Manual