Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (FAM62B antibody (MBS5302611) used at 1 ug/ml to detect target protein.)

Rabbit anti-Human, Mouse FAM62B Polyclonal Antibody | anti-FAM62B antibody

FAM62B antibody

Reactivity
Human, Mouse
Applications
Western Blot
Purity
Affinity purified
Synonyms
FAM62B; Polyclonal Antibody; FAM62B antibody; Polyclonal FAM62B; Anti-FAM62B; Family With Sequence Similarity 62; FAM-62; C2 Domain Containing Member B; KIAA1228; ESYT2; FAM 62; CHR2SYT; FAM62; anti-FAM62B antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FAM62B antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
158
Applicable Applications for anti-FAM62B antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
FAM62B may play a role as calcium-regulated intrinsic membrane protein.
Cross-Reactivity
Human,Mouse
Immunogen
FAM62B antibody was raised using a synthetic peptide corresponding to a region with amino acids NSGPNSTIKMKIALRVLHLEKRERPPDHQHSAQVKRPSVSKEGRKTSIKS
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(FAM62B antibody (MBS5302611) used at 1 ug/ml to detect target protein.)

Western Blot (WB) (FAM62B antibody (MBS5302611) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-FAM62B antibody
Rabbit polyclonal FAM62B antibody
Product Categories/Family for anti-FAM62B antibody

NCBI and Uniprot Product Information

NCBI GI #
UniProt Accession #
Molecular Weight
99 kDa (MW of target protein)
NCBI Official Full Name
FAM62B, partial
UniProt Protein Name
Extended synaptotagmin-2
UniProt Gene Name
ESYT2
UniProt Synonym Gene Names
FAM62B; KIAA1228; E-Syt2
UniProt Entry Name
ESYT2_HUMAN

Uniprot Description

ESYT2: May play a role as calcium-regulated intrinsic membrane protein. Belongs to the extended synaptotagmin family. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 7q36.3

Cellular Component: intrinsic to endoplasmic reticulum membrane; extrinsic to internal side of plasma membrane; membrane; integral to plasma membrane

Molecular Function: identical protein binding; protein binding; phosphatidylethanolamine binding; calcium-dependent phospholipid binding; calcium ion binding; phosphatidylcholine binding; phosphoinositide binding

Biological Process: endocytosis; lipid transport

Similar Products

Product Notes

The FAM62B esyt2 (Catalog #AAA5302611) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FAM62B antibody reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's FAM62B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the FAM62B esyt2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "FAM62B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.