Western Blot (WB)
(FAM82A antibody (MBS5302205) used at 1 ug/ml to detect target protein.)
Rabbit FAM82A Polyclonal Antibody | anti-FAM82A antibody
FAM82A antibody
Gene Names
RMDN2; RMD2; RMD4; RMD-2; FAM82A; BLOCK18; FAM82A1; PRO34163; PYST9371
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity purified
Synonyms
FAM82A; Polyclonal Antibody; FAM82A antibody; Polyclonal FAM82A; Anti-FAM82A; FAM 82; Family With Sequence Similarity 82 Member A; FLJ38143; MGC33318; PRO34163; FAM-82; FLJ32954; BLOCK18; PYST9371; FAM82; anti-FAM82A antibody
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Specificity
FAM82A antibody was raised against the middle region of Fam82A
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FAM82A antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
410
Applicable Applications for anti-FAM82A antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
FAM82A belongs to the FAM82/RMD family. It is a single-pass membrane protein. The function of the FAM82A protein remains unknown.
Cross-Reactivity
Human,Mouse,Rat
Immunogen
FAM82A antibody was raised using the middle region of Fam82A corresponding to a region with amino acids RAPMNGHCHLWYAVLCGYVSEFEGLQNKINYGHLFKEHLDIAIKLLPEEP
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Western Blot (WB)
(FAM82A antibody (MBS5302205) used at 1 ug/ml to detect target protein.)
Western Blot (WB)
(FAM82A antibody (MBS5302205) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-FAM82A antibody
Rabbit polyclonal FAM82A antibody raised against the middle region of Fam82A
Product Categories/Family for anti-FAM82A antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
65 kDa (MW of target protein)
NCBI Official Full Name
family with sequence similarity 82, member A, isoform CRA_d
NCBI Official Synonym Full Names
regulator of microtubule dynamics 2
NCBI Official Symbol
RMDN2
NCBI Official Synonym Symbols
RMD2; RMD4; RMD-2; FAM82A; BLOCK18; FAM82A1; PRO34163; PYST9371
NCBI Protein Information
regulator of microtubule dynamics protein 2
UniProt Protein Name
Regulator of microtubule dynamics protein 2
UniProt Gene Name
RMDN2
UniProt Synonym Gene Names
FAM82A; FAM82A1; RMD-2; hRMD-2
UniProt Entry Name
RMD2_HUMAN
Uniprot Description
FAM82A1: Belongs to the FAM82/RMD family. 4 isoforms of the human protein are produced by alternative splicing.
Protein type: Membrane protein, integral
Chromosomal Location of Human Ortholog: 2p22.2
Cellular Component: spindle pole; microtubule; mitochondrion; cytoplasm; integral to membrane
Research Articles on FAM82A
Similar Products
Product Notes
The FAM82A rmdn2 (Catalog #AAA5302205) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FAM82A antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's FAM82A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the FAM82A rmdn2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "FAM82A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
