Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-FAM121B Antibody Titration: 1.25ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysate)

Rabbit FAM121B Polyclonal Antibody | anti-APOO antibody

FAM121B antibody - N-terminal region

Gene Names
APOO; MIC26; Mic23; My025; FAM121B; MICOS26
Reactivity
Guinea Pig, Horse, Human, Rabbit
Applications
Western Blot
Purity
Protein A purified
Synonyms
FAM121B; Polyclonal Antibody; FAM121B antibody - N-terminal region; anti-APOO antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Guinea Pig, Horse, Human, Rabbit
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PASLSLLTFKVYAAPKKDSPPKNSVKVDELSLYSVPEGQSKYVEEARSQL
Sequence Length
198
Applicable Applications for anti-APOO antibody
Western Blot (WB)
Homology
Guinea Pig: 93%; Horse: 85%; Human: 100%; Rabbit: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human FAM121B
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-FAM121B Antibody Titration: 1.25ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysate)

Western Blot (WB) (WB Suggested Anti-FAM121B Antibody Titration: 1.25ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysate)
Related Product Information for anti-APOO antibody
This is a rabbit polyclonal antibody against FAM121B. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: FAM121B belongs to the FAM121 family and the function remains unknown.
Product Categories/Family for anti-APOO antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
22kDa
NCBI Official Full Name
MICOS complex subunit MIC26
NCBI Official Synonym Full Names
apolipoprotein O
NCBI Official Symbol
APOO
NCBI Official Synonym Symbols
MIC26; Mic23; My025; FAM121B; MICOS26
NCBI Protein Information
MICOS complex subunit MIC26
UniProt Protein Name
Apolipoprotein O
Protein Family
UniProt Gene Name
APOO
UniProt Synonym Gene Names
FAM121B
UniProt Entry Name
APOO_HUMAN

NCBI Description

This gene is a member of the apolipoprotein family. Members of this protein family are involved in the transport and metabolism of lipids. The encoded protein associates with HDL, LDL and VLDL lipoproteins and is characterized by chondroitin-sulfate glycosylation. This protein may be involved in preventing lipid accumulation in the myocardium in obese and diabetic patients. Alternative splicing results in multiple transcript variants. Pseudogenes of this gene are found on chromosomes 3, 4, 5, 12 and 16.[provided by RefSeq, Sep 2009]

Uniprot Description

APOO: Promotes cholesterol efflux from macrophage cells. Detected in HDL, LDL and VLDL. Secreted by a microsomal triglyceride transfer protein (MTTP)-dependent mechanism, probably as a VLDL-associated protein that is subsequently transferred to HDL. May be involved in myocardium-protective mechanisms against lipid accumulation. Belongs to the apolipoprotein O family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: Xp22.11

Cellular Component: extracellular space; mitochondrion; integral to membrane

Biological Process: lipid transport

Research Articles on APOO

Similar Products

Product Notes

The APOO apoo (Catalog #AAA3205592) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FAM121B antibody - N-terminal region reacts with Guinea Pig, Horse, Human, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's FAM121B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the APOO apoo for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PASLSLLTFK VYAAPKKDSP PKNSVKVDEL SLYSVPEGQS KYVEEARSQL. It is sometimes possible for the material contained within the vial of "FAM121B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.