Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-GTPBP9 Antibody Titration: 1.25ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysateOLA1 is supported by BioGPS gene expression data to be expressed in HepG2)

Rabbit GTPBP9 Polyclonal Antibody | anti-OLA1 antibody

GTPBP9 antibody - N-terminal region

Gene Names
OLA1; DOC45; GBP45; GTBP9; GTPBP9; PTD004
Reactivity
Cow, Human, Mouse, Rat
Applications
Western Blot
Purity
Protein A purified
Synonyms
GTPBP9; Polyclonal Antibody; GTPBP9 antibody - N-terminal region; anti-OLA1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GLPNVGKSTFFNVLTNSQASAENFPFCTIDPNESRVPVPDERFDFLCQYH
Sequence Length
396
Applicable Applications for anti-OLA1 antibody
Western Blot (WB)
Homology
Cow: 100%; Human: 100%; Mouse: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human GTPBP9
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-GTPBP9 Antibody Titration: 1.25ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysateOLA1 is supported by BioGPS gene expression data to be expressed in HepG2)

Western Blot (WB) (WB Suggested Anti-GTPBP9 Antibody Titration: 1.25ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysateOLA1 is supported by BioGPS gene expression data to be expressed in HepG2)
Related Product Information for anti-OLA1 antibody
This is a rabbit polyclonal antibody against GTPBP9. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: GTPBP9 belongs to the GTP1/OBG family and the function remains unknown.
Product Categories/Family for anti-OLA1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
44kDa
NCBI Official Full Name
obg-like ATPase 1 isoform 2
NCBI Official Synonym Full Names
Obg like ATPase 1
NCBI Official Symbol
OLA1
NCBI Official Synonym Symbols
DOC45; GBP45; GTBP9; GTPBP9; PTD004
NCBI Protein Information
obg-like ATPase 1
UniProt Protein Name
Obg-like ATPase 1
Protein Family
UniProt Gene Name
OLA1
UniProt Synonym Gene Names
DOC45
UniProt Entry Name
OLA1_HUMAN

NCBI Description

This gene encodes a member of the GTPase protein family. The encoded protein interacts with breast cancer-associated gene 1 (BRCA1) and BRCA1-associated RING domain protein (BARD1), and is involved in centrosome regulation. Overexpression of this gene has been observed in multiple types of cancer and may be associated with poor survival. Pseudogenes of this gene have been defined on chromosomes 17 and 22. [provided by RefSeq, Jun 2016]

Uniprot Description

OLA1: Hydrolyzes ATP, and can also hydrolyze GTP with lower efficiency. Has lower affinity for GTP. Belongs to the GTP1/OBG family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Nucleolus; EC 3.6.3.-; Hydrolase

Chromosomal Location of Human Ortholog: 2q31.1

Cellular Component: centrosome; membrane; cytoplasm; nucleolus

Molecular Function: protein binding; GTP binding; metal ion binding; ATPase activity; ribosome binding; ATP binding; ribosomal large subunit binding

Biological Process: metabolic process

Research Articles on OLA1

Similar Products

Product Notes

The OLA1 ola1 (Catalog #AAA3205446) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GTPBP9 antibody - N-terminal region reacts with Cow, Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's GTPBP9 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the OLA1 ola1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GLPNVGKSTF FNVLTNSQAS AENFPFCTID PNESRVPVPD ERFDFLCQYH. It is sometimes possible for the material contained within the vial of "GTPBP9, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.