Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of EYA2 expression in transfected 293T cell line by EYA2 polyclonal antibody. Lane 1: EYA2 transfected lysate (59.2kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human EYA2 Polyclonal Antibody | anti-EYA2 antibody

EYA2 (Eyes Absent Homolog 2, EAB1) (Biotin)

Gene Names
EYA2; EAB1
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
EYA2; Polyclonal Antibody; EYA2 (Eyes Absent Homolog 2; EAB1) (Biotin); anti-EYA2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human EYA2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-EYA2 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human EYA2, aa1-538 (NP_005235.3).
Immunogen Sequence
MVELVISPSLTVNSDCLDKLKFNRADAAVWTLSDRQGITKSAPLRVSQLFSRSCPRVLPRQPSTAMAAYGQTQYSAGIQQATPYTAYPPPAQAYGIPSYSIKTEDSLNHSPGQSGFLSYGSSFSTSPTGQSPYTYQMHGTTGFYQGGNGLGNAAGFGSVHQDYPSYPGFPQSQYPQYYGSSYNPPYVPASSICPSPLSTSTYVLQEASHNVPNQSSESLAGEYNTHNGPSTPAKEGDTDRPHRASDGKLRGRSKRSSDPSPAGDNEIERVFVWDLDETIIIFHSLLTGTFASRYGKDTTTSVRIGLMMEEMIFNLADTHLFFNDLEDCDQIHVDDVSSDDNGQDLSTYNFSADGFHSSAPGANLCLGSGVHGGVDWMRKLAFRYRRVKEMYNTYKNNVGGLIGTPKRETWLQLRAELEALTDLWLTHSLKALNLINSRPNCVNVLVTTTQLIPALAKVLLYGLGSVFPIENIYSATKTGKESCFERIMQRFGRKAVYVVIGDGVEEEQGAKKHNMPFWRISCHADLEALRHALELEYL
Conjugate
Biotin
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of EYA2 expression in transfected 293T cell line by EYA2 polyclonal antibody. Lane 1: EYA2 transfected lysate (59.2kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of EYA2 expression in transfected 293T cell line by EYA2 polyclonal antibody. Lane 1: EYA2 transfected lysate (59.2kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-EYA2 antibody
This gene encodes a member of the eyes absent (EYA) family of proteins. The encoded protein may be post-translationally modified and may play a role in eye development. A similar protein in mice can act as a transcriptional activator. Alternative splicing results in multiple transcript variants, but the full-length natures of all of these variants have not yet been determined.
Product Categories/Family for anti-EYA2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
50,533 Da
NCBI Official Full Name
eyes absent homolog 2 isoform a
NCBI Official Synonym Full Names
EYA transcriptional coactivator and phosphatase 2
NCBI Official Symbol
EYA2
NCBI Official Synonym Symbols
EAB1
NCBI Protein Information
eyes absent homolog 2
UniProt Protein Name
Eyes absent homolog 2
Protein Family
UniProt Gene Name
EYA2
UniProt Synonym Gene Names
EAB1
UniProt Entry Name
EYA2_HUMAN

NCBI Description

This gene encodes a member of the eyes absent (EYA) family of proteins. The encoded protein may be post-translationally modified and may play a role in eye development. A similar protein in mice can act as a transcriptional activator. Alternative splicing results in multiple transcript variants, but the full-length natures of all of these variants have not yet been determined. [provided by RefSeq, Jul 2009]

Uniprot Description

EYA2: Tyrosine phosphatase that specifically dephosphorylates 'Tyr-142' of histone H2AX (H2AXY142ph). 'Tyr-142' phosphorylation of histone H2AX plays a central role in DNA repair and acts as a mark that distinguishes between apoptotic and repair responses to genotoxic stress. Promotes efficient DNA repair by dephosphorylating H2AX, promoting the recruitment of DNA repair complexes containing MDC1. Its function as histone phosphatase probably explains its role in transcription regulation during organogenesis. Coactivates SIX1. Seems to coactivate SIX2, SIX4 and SIX5. Together with SIX1 and DACH2 seem to be involved in myogenesis. May be involved in development of the eye. Interaction with GNAZ and GNAI2 prevents nuclear translocation and transcriptional activity. Belongs to the HAD-like hydrolase superfamily. EYA family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 3.1.3.48; Cell development/differentiation; Protein phosphatase, tyrosine (non-receptor); Apoptosis

Chromosomal Location of Human Ortholog: 20q13.1

Cellular Component: centrosome; mitochondrion; cytoplasm; nucleus

Molecular Function: protein binding; magnesium ion binding; protein tyrosine phosphatase activity

Biological Process: histone dephosphorylation; striated muscle development; regulation of transcription, DNA-dependent; transcription, DNA-dependent; mesodermal cell fate specification; DNA repair

Research Articles on EYA2

Similar Products

Product Notes

The EYA2 eya2 (Catalog #AAA6377802) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The EYA2 (Eyes Absent Homolog 2, EAB1) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's EYA2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the EYA2 eya2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "EYA2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.