Rabbit anti-Human EYA2 Polyclonal Antibody | anti-EYA2 antibody

EYA2 (Eyes Absent Homolog 2, EAB1) (Biotin)

Cat. Num. AAA6377802

• Gene Names: EYA2; EAB1
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: EYA2; Polyclonal Antibody; EYA2 (Eyes Absent Homolog 2; EAB1) (Biotin); anti-EYA2 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human EYA2.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-EYA2 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human EYA2, aa1-538 (NP_005235.3).
• Immunogen Sequence: MVELVISPSLTVNSDCLDKLKFNRADAAVWTLSDRQGITKSAPLRVSQLFSRSCPRVLPRQPSTAMAAYGQTQYSAGIQQATPYTAYPPPAQAYGIPSYSIKTEDSLNHSPGQSGFLSYGSSFSTSPTGQSPYTYQMHGTTGFYQGGNGLGNAAGFGSVHQDYPSYPGFPQSQYPQYYGSSYNPPYVPASSICPSPLSTSTYVLQEASHNVPNQSSESLAGEYNTHNGPSTPAKEGDTDRPHRASDGKLRGRSKRSSDPSPAGDNEIERVFVWDLDETIIIFHSLLTGTFASRYGKDTTTSVRIGLMMEEMIFNLADTHLFFNDLEDCDQIHVDDVSSDDNGQDLSTYNFSADGFHSSAPGANLCLGSGVHGGVDWMRKLAFRYRRVKEMYNTYKNNVGGLIGTPKRETWLQLRAELEALTDLWLTHSLKALNLINSRPNCVNVLVTTTQLIPALAKVLLYGLGSVFPIENIYSATKTGKESCFERIMQRFGRKAVYVVIGDGVEEEQGAKKHNMPFWRISCHADLEALRHALELEYL
• Conjugate: Biotin
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of EYA2 expression in transfected 293T cell line by EYA2 polyclonal antibody. Lane 1: EYA2 transfected lysate (59.2kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-EYA2 antibody

This gene encodes a member of the eyes absent (EYA) family of proteins. The encoded protein may be post-translationally modified and may play a role in eye development. A similar protein in mice can act as a transcriptional activator. Alternative splicing results in multiple transcript variants, but the full-length natures of all of these variants have not yet been determined.

Product Categories/Family for anti-EYA2 antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 26667227
• NCBI GeneID: 2139
• NCBI Accession #: NP_005235.3
• NCBI GenBank Nucleotide #: NM_005244.3
• UniProt Accession #: O00167; Q5JSW8; Q86U84; Q96CV6; Q96H97; Q99503; Q99812; Q9BWF6; Q9H4S3; Q9H4S9; Q9NPZ4; Q9UIX7
• Molecular Weight: 50,533 Da
• NCBI Official Full Name: eyes absent homolog 2 isoform a
• NCBI Official Synonym Full Names: EYA transcriptional coactivator and phosphatase 2
• NCBI Official Symbol: EYA2
• NCBI Official Synonym Symbols: EAB1
• NCBI Protein Information: eyes absent homolog 2
• UniProt Protein Name: Eyes absent homolog 2
• Protein Family: Eyes absent
• UniProt Gene Name: EYA2
• UniProt Synonym Gene Names: EAB1
• UniProt Entry Name: EYA2_HUMAN

NCBI Description

This gene encodes a member of the eyes absent (EYA) family of proteins. The encoded protein may be post-translationally modified and may play a role in eye development. A similar protein in mice can act as a transcriptional activator. Alternative splicing results in multiple transcript variants, but the full-length natures of all of these variants have not yet been determined. [provided by RefSeq, Jul 2009]

Uniprot Description

EYA2: Tyrosine phosphatase that specifically dephosphorylates 'Tyr-142' of histone H2AX (H2AXY142ph). 'Tyr-142' phosphorylation of histone H2AX plays a central role in DNA repair and acts as a mark that distinguishes between apoptotic and repair responses to genotoxic stress. Promotes efficient DNA repair by dephosphorylating H2AX, promoting the recruitment of DNA repair complexes containing MDC1. Its function as histone phosphatase probably explains its role in transcription regulation during organogenesis. Coactivates SIX1. Seems to coactivate SIX2, SIX4 and SIX5. Together with SIX1 and DACH2 seem to be involved in myogenesis. May be involved in development of the eye. Interaction with GNAZ and GNAI2 prevents nuclear translocation and transcriptional activity. Belongs to the HAD-like hydrolase superfamily. EYA family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 3.1.3.48; Cell development/differentiation; Protein phosphatase, tyrosine (non-receptor); Apoptosis

Chromosomal Location of Human Ortholog: 20q13.1

Cellular Component: centrosome; mitochondrion; cytoplasm; nucleus

Molecular Function: protein binding; magnesium ion binding; protein tyrosine phosphatase activity

Biological Process: histone dephosphorylation; striated muscle development; regulation of transcription, DNA-dependent; transcription, DNA-dependent; mesodermal cell fate specification; DNA repair