Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of extracts of various cell lines, using EREG antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)

Rabbit EREG Polyclonal Antibody | anti-EREG antibody

EREG Rabbit pAb

Gene Names
EREG; ER; Ep; EPR
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity purification
Synonyms
EREG; Polyclonal Antibody; EREG Rabbit pAb; EPR; ER; Ep; anti-EREG antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
GVRCEHFFLTVHQPLSKEYVALTVILIILFLITVVGSTYYFCRWYRNRKSKEPKKEYERVTSGDPELPQV
Applicable Applications for anti-EREG antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Customer Validation: WB: Mouse
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 100 to the C-terminus of human EREG (NP_001423.1).
Cellular Location
Cell membrane, Secreted, Single-pass type I membrane protein, extracellular space
Positive Samples
HepG2, SW480, U-87MG, Mouse lung, Rat thymus
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot analysis of extracts of various cell lines, using EREG antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)

Western Blot (WB) (Western blot analysis of extracts of various cell lines, using EREG antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)
Related Product Information for anti-EREG antibody
Background: This gene encodes a secreted peptide hormone and member of the epidermal growth factor (EGF) family of proteins. The encoded protein is a ligand of the epidermal growth factor receptor (EGFR) and the structurally related erb-b2 receptor tyrosine kinase 4 (ERBB4). The encoded protein may be involved in a wide range of biological processes including inflammation, wound healing, oocyte maturation, and cell proliferation. Additionally, the encoded protein may promote the progression of cancers of various human tissues.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
19,044 Da
NCBI Official Full Name
proepiregulin preproprotein
NCBI Official Synonym Full Names
epiregulin
NCBI Official Symbol
EREG
NCBI Official Synonym Symbols
ER; Ep; EPR
NCBI Protein Information
proepiregulin
UniProt Protein Name
Proepiregulin
Protein Family
UniProt Gene Name
EREG
UniProt Synonym Gene Names
EPR
UniProt Entry Name
EREG_HUMAN

Uniprot Description

Epiregulin: Ligand of the EGF receptor/EGFR and ERBB4. May be a mediator of localized cell proliferation. As a mitogen it may stimulate cell proliferation and/or angiogenesis.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 4q13.3

Cellular Component: extracellular region; extracellular space; integral to plasma membrane

Molecular Function: epidermal growth factor receptor binding; growth factor activity; phosphatidylinositol-4,5-bisphosphate 3-kinase activity; protein binding; protein-tyrosine kinase activity; Ras guanyl-nucleotide exchange factor activity

Biological Process: anatomical structure morphogenesis; cell-cell signaling; cytokine and chemokine mediated signaling pathway; epidermal growth factor receptor signaling pathway; female meiosis; keratinocyte differentiation; keratinocyte proliferation; luteinizing hormone signaling pathway; MAPKKK cascade; mRNA transcription; negative regulation of cell proliferation; negative regulation of epithelial cell proliferation; negative regulation of smooth muscle cell differentiation; negative regulation of transcription, DNA-dependent; oocyte maturation; organ morphogenesis; ovarian cumulus expansion; ovulation; phosphoinositide-mediated signaling; positive regulation of cell proliferation; positive regulation of cytokine biosynthetic process; positive regulation of cytokine production; positive regulation of DNA replication; positive regulation of epidermal growth factor receptor activity; positive regulation of fibroblast proliferation; positive regulation of innate immune response; positive regulation of interleukin-6 biosynthetic process; positive regulation of mitosis; positive regulation of phosphorylation; positive regulation of protein kinase activity; positive regulation of smooth muscle cell proliferation; primary follicle stage, oogenesis; regulation of phosphoinositide 3-kinase cascade; wound healing

Similar Products

Product Notes

The EREG ereg (Catalog #AAA9142291) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The EREG Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's EREG can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000 Customer Validation: WB: Mouse. Researchers should empirically determine the suitability of the EREG ereg for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: GVRCEHFFLT VHQPLSKEYV ALTVILIILF LITVVGSTYY FCRWYRNRKS KEPKKEYERV TSGDPELPQV. It is sometimes possible for the material contained within the vial of "EREG, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.