Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: EREGSample Tissue: Human THP-1 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human EREG Polyclonal Antibody | anti-EREG antibody

EREG Antibody - middle region

Gene Names
EREG; ER; Ep; EPR
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
EREG; Polyclonal Antibody; EREG Antibody - middle region; anti-EREG antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: CEHFFLTVHQPLSKEYVALTVILIILFLITVVGSTYYFCRWYRNRKSKEP
Sequence Length
169
Applicable Applications for anti-EREG antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human EREG
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: EREGSample Tissue: Human THP-1 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: EREGSample Tissue: Human THP-1 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-EREG antibody
This gene encodes a secreted peptide hormone and member of the epidermal growth factor (EGF) family of proteins. The encoded protein is a ligand of the epidermal growth factor receptor (EGFR) and the structurally related erb-b2 receptor tyrosine kinase 4 (ERBB4). The encoded protein may be involved in a wide range of biological processes including inflammation, wound healing, oocyte maturation, and cell proliferation. Additionally, the encoded protein may promote the progression of cancers of various human tissues.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
18 kDa
NCBI Official Full Name
proepiregulin preproprotein
NCBI Official Synonym Full Names
epiregulin
NCBI Official Symbol
EREG
NCBI Official Synonym Symbols
ER; Ep; EPR
NCBI Protein Information
proepiregulin
UniProt Protein Name
Proepiregulin
Protein Family
UniProt Gene Name
EREG
UniProt Synonym Gene Names
EPR
UniProt Entry Name
EREG_HUMAN

NCBI Description

This gene encodes a secreted peptide hormone and member of the epidermal growth factor (EGF) family of proteins. The encoded protein is a ligand of the epidermal growth factor receptor (EGFR) and the structurally related erb-b2 receptor tyrosine kinase 4 (ERBB4). The encoded protein may be involved in a wide range of biological processes including inflammation, wound healing, oocyte maturation, and cell proliferation. Additionally, the encoded protein may promote the progression of cancers of various human tissues. [provided by RefSeq, Jul 2015]

Uniprot Description

Epiregulin: Ligand of the EGF receptor/EGFR and ERBB4. May be a mediator of localized cell proliferation. As a mitogen it may stimulate cell proliferation and/or angiogenesis.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 4q13.3

Cellular Component: extracellular region; extracellular space; integral to plasma membrane

Molecular Function: epidermal growth factor receptor binding; growth factor activity; phosphatidylinositol-4,5-bisphosphate 3-kinase activity; protein binding; protein-tyrosine kinase activity; Ras guanyl-nucleotide exchange factor activity

Biological Process: anatomical structure morphogenesis; cell-cell signaling; cytokine and chemokine mediated signaling pathway; epidermal growth factor receptor signaling pathway; female meiosis; keratinocyte differentiation; keratinocyte proliferation; luteinizing hormone signaling pathway; MAPKKK cascade; mRNA transcription; negative regulation of cell proliferation; negative regulation of epithelial cell proliferation; negative regulation of smooth muscle cell differentiation; negative regulation of transcription, DNA-dependent; oocyte maturation; organ morphogenesis; ovarian cumulus expansion; ovulation; phosphoinositide-mediated signaling; positive regulation of cell proliferation; positive regulation of cytokine biosynthetic process; positive regulation of cytokine production; positive regulation of DNA replication; positive regulation of epidermal growth factor receptor activity; positive regulation of fibroblast proliferation; positive regulation of innate immune response; positive regulation of interleukin-6 biosynthetic process; positive regulation of mitosis; positive regulation of phosphorylation; positive regulation of protein kinase activity; positive regulation of smooth muscle cell proliferation; primary follicle stage, oogenesis; regulation of phosphoinositide 3-kinase cascade; wound healing

Research Articles on EREG

Similar Products

Product Notes

The EREG ereg (Catalog #AAA3221064) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The EREG Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's EREG can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the EREG ereg for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: CEHFFLTVHQ PLSKEYVALT VILIILFLIT VVGSTYYFCR WYRNRKSKEP. It is sometimes possible for the material contained within the vial of "EREG, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.