Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-ENOX2 antibody Titration: 1 ug/mLSample Type: Human Lymph Node Tumor)

Rabbit ENOX2 Polyclonal Antibody | anti-ENOX2 antibody

ENOX2 Antibody - middle region

Gene Names
ENOX2; APK1; tNOX; COVA1
Reactivity
Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity purified
Synonyms
ENOX2; Polyclonal Antibody; ENOX2 Antibody - middle region; anti-ENOX2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: NEVELLKQEQGKVHREDDPNKEQQLKLLQQALQGMQQHLLKVQEEYKKKE
Sequence Length
581
Applicable Applications for anti-ENOX2 antibody
Western Blot (WB)
Homology
Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human ENOX2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-ENOX2 antibody Titration: 1 ug/mLSample Type: Human Lymph Node Tumor)

Western Blot (WB) (WB Suggested Anti-ENOX2 antibody Titration: 1 ug/mLSample Type: Human Lymph Node Tumor)
Related Product Information for anti-ENOX2 antibody
This is a rabbit polyclonal antibody against ENOX2. It was validated on Western Blot

Target Description: This gene is a tumor-specific member of the ECTO-NOX family of genes that encode cell surface NADH oxidases. The encoded protein has two enzymatic activities: catalysis of hydroquinone or NADH oxidation, and protein disulfide interchange. The protein also displays prion-like properties. Alternative splicing results in multiple transcript variants.
Product Categories/Family for anti-ENOX2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
63 kDa
NCBI Official Full Name
ecto-NOX disulfide-thiol exchanger 2 isoform a
NCBI Official Synonym Full Names
ecto-NOX disulfide-thiol exchanger 2
NCBI Official Symbol
ENOX2
NCBI Official Synonym Symbols
APK1; tNOX; COVA1
NCBI Protein Information
ecto-NOX disulfide-thiol exchanger 2
UniProt Protein Name
Ecto-NOX disulfide-thiol exchanger 2
UniProt Gene Name
ENOX2
UniProt Synonym Gene Names
COVA1; tNOX

NCBI Description

This gene is a tumor-specific member of the ECTO-NOX family of genes that encode cell surface NADH oxidases. The encoded protein has two enzymatic activities: catalysis of hydroquinone or NADH oxidation, and protein disulfide interchange. The protein also displays prion-like properties. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2013]

Uniprot Description

ENOX2: May be involved in cell growth. Probably acts as a terminal oxidase of plasma electron transport from cytosolic NAD(P)H via hydroquinones to acceptors at the cell surface. Hydroquinone oxidase activity alternates with a protein disulfide- thiol interchange/oxidoreductase activity which may control physical membrane displacements associated with vesicle budding or cell enlargement. The activities oscillate with a period length of 22 minutes and play a role in control of the ultradian cellular biological clock. Belongs to the ENOX family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Cell surface; Cytoskeletal; EC 1.-.-.-; Oxidoreductase

Chromosomal Location of Human Ortholog: Xq26.1

Cellular Component: cytosol; external side of plasma membrane

Molecular Function: protein disulfide oxidoreductase activity

Biological Process: ultradian rhythm

Research Articles on ENOX2

Similar Products

Product Notes

The ENOX2 enox2 (Catalog #AAA3214547) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ENOX2 Antibody - middle region reacts with Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ENOX2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ENOX2 enox2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NEVELLKQEQ GKVHREDDPN KEQQLKLLQQ ALQGMQQHLL KVQEEYKKKE. It is sometimes possible for the material contained within the vial of "ENOX2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.