Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Rabbit Anti-EMP2 AntibodyParaffin Embedded Tissue: Human LungCellular Data: Alveolar cellsAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

Rabbit anti-Cow, Human EMP2 Polyclonal Antibody | anti-EMP2 antibody

EMP2 antibody - middle region

Gene Names
EMP2; XMP
Reactivity
Cow, Human
Applications
Immunohistochemistry, Western Blot
Purity
Protein A purified
Synonyms
EMP2; Polyclonal Antibody; EMP2 antibody - middle region; anti-EMP2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Human
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: IQLMSCLCVMIAASIYTDRREDIHDKNAKFYPVTREGSYGYSYILAWVAF
Sequence Length
167
Applicable Applications for anti-EMP2 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 82%; Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human EMP2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Rabbit Anti-EMP2 AntibodyParaffin Embedded Tissue: Human LungCellular Data: Alveolar cellsAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

Immunohistochemistry (IHC) (Rabbit Anti-EMP2 AntibodyParaffin Embedded Tissue: Human LungCellular Data: Alveolar cellsAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

Western Blot (WB)

(WB Suggested Anti-EMP2 Antibody Titration: 1.25ug/mlPositive Control: HepG2 cell lysate)

Western Blot (WB) (WB Suggested Anti-EMP2 Antibody Titration: 1.25ug/mlPositive Control: HepG2 cell lysate)
Related Product Information for anti-EMP2 antibody
This is a rabbit polyclonal antibody against EMP2. It was validated on Western Blot and immunohistochemistry

Target Description: Epithelial membrane protein-2 (EMP2) is a member of the four transmembrane superfamily (TM4SF) and is thought to mediate trafficking of diverse proteins such as alpha6beta1 integrin and MHC class I to lipid raft microdomains. EMP2 has also recently been recognized as a putative tumor suppressor gene in certain model systems.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
19kDa
NCBI Official Full Name
epithelial membrane protein 2
NCBI Official Synonym Full Names
epithelial membrane protein 2
NCBI Official Symbol
EMP2
NCBI Official Synonym Symbols
XMP
NCBI Protein Information
epithelial membrane protein 2
UniProt Protein Name
Epithelial membrane protein 2
UniProt Gene Name
EMP2
UniProt Synonym Gene Names
XMP; EMP-2
UniProt Entry Name
EMP2_HUMAN

NCBI Description

This gene encodes a tetraspan protein of the PMP22/EMP family. The encoded protein regulates cell membrane composition. It has been associated with various functions including endocytosis, cell signaling, cell proliferation, cell migration, cell adhesion, cell death, cholesterol homeostasis, urinary albumin excretion, and embryo implantation. It is known to negatively regulate caveolin-1, a scaffolding protein which is the main component of the caveolae plasma membrane invaginations found in most cell types. Through activation of PTK2 it positively regulates vascular endothelial growth factor A. It also modulates the function of specific integrin isomers in the plasma membrane. Up-regulation of this gene has been linked to cancer progression in multiple different tissues. Mutations in this gene have been associated with nephrotic syndrome type 10 (NPHS10). [provided by RefSeq, Mar 2015]

Uniprot Description

EMP2: Belongs to the PMP-22/EMP/MP20 family.

Protein type: Membrane protein, integral; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 16p13.2

Cellular Component: Golgi membrane; Golgi apparatus; cell surface; apical part of cell; apical plasma membrane; cytoplasm; integral to membrane; plasma membrane; caveola; cytoplasmic vesicle; nucleus; lipid raft

Molecular Function: integrin binding; protein binding; kinase binding; protein kinase binding

Biological Process: cell death; regulation of kinase activity; cell migration; blood vessel endothelial cell migration; cell-matrix adhesion; actin filament organization; bleb formation; lipid raft formation; regulation of angiogenesis; cell proliferation; regulation of glomerular filtration; early endosome to late endosome transport; positive regulation of cell proliferation; activation of protein kinase activity; positive regulation of cell-matrix adhesion; cell adhesion; embryo implantation; T cell mediated cytotoxicity

Disease: Nephrotic Syndrome, Type 10

Research Articles on EMP2

Similar Products

Product Notes

The EMP2 emp2 (Catalog #AAA3205868) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The EMP2 antibody - middle region reacts with Cow, Human and may cross-react with other species as described in the data sheet. AAA Biotech's EMP2 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the EMP2 emp2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: IQLMSCLCVM IAASIYTDRR EDIHDKNAKF YPVTREGSYG YSYILAWVAF. It is sometimes possible for the material contained within the vial of "EMP2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.