Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Rabbit Anti-SLC22A1 AntibodyParaffin Embedded Tissue: Human IntestineCellular Data: Epithelial cells of intestinal villasAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

Rabbit anti-Human SLC22A1 Polyclonal Antibody | anti-SLC22A1 antibody

SLC22A1 antibody - C-terminal region

Gene Names
SLC22A1; OCT1; HOCT1; oct1_cds
Reactivity
Human
Applications
Immunohistochemistry, Western Blot
Purity
Protein A purified
Synonyms
SLC22A1; Polyclonal Antibody; SLC22A1 antibody - C-terminal region; anti-SLC22A1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: IAIQMICLVNAELYPTFVSGVGPACRGSDATSSRDQGGRFARDHEGRREP
Sequence Length
506
Applicable Applications for anti-SLC22A1 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human SLC22A1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Rabbit Anti-SLC22A1 AntibodyParaffin Embedded Tissue: Human IntestineCellular Data: Epithelial cells of intestinal villasAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

Immunohistochemistry (IHC) (Rabbit Anti-SLC22A1 AntibodyParaffin Embedded Tissue: Human IntestineCellular Data: Epithelial cells of intestinal villasAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

Western Blot (WB)

(WB Suggested Anti-SLC22A1 Antibody Titration: 5.0ug/mlPositive Control: HepG2 cell lysate)

Western Blot (WB) (WB Suggested Anti-SLC22A1 Antibody Titration: 5.0ug/mlPositive Control: HepG2 cell lysate)
Related Product Information for anti-SLC22A1 antibody
This is a rabbit polyclonal antibody against SLC22A1. It was validated on Western Blot and immunohistochemistry

Target Description: Polyspecific organic cation transporters in the liver, kidney, intestine, and other organs are critical for elimination of many endogenous small organic cations as well as a wide array of drugs and environmental toxins. The protein contains twelve putative transmembrane domains and is a plasma integral membrane protein.Polyspecific organic cation transporters in the liver, kidney, intestine, and other organs are critical for elimination of many endogenous small organic cations as well as a wide array of drugs and environmental toxins. This gene is one of three similar cation transporter genes located in a cluster on chromosome 6. The encoded protein contains twelve putative transmembrane domains and is a plasma integral membrane protein. Two transcript variants encoding two different isoforms have been found for this gene, but only the longer variant encodes a functional transporter.
Product Categories/Family for anti-SLC22A1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
56kDa
NCBI Official Full Name
Solute carrier family 22 member 1
NCBI Official Synonym Full Names
solute carrier family 22 member 1
NCBI Official Symbol
SLC22A1
NCBI Official Synonym Symbols
OCT1; HOCT1; oct1_cds
NCBI Protein Information
solute carrier family 22 member 1
UniProt Protein Name
Solute carrier family 22 member 1
Protein Family
UniProt Gene Name
SLC22A1
UniProt Synonym Gene Names
OCT1; hOCT1
UniProt Entry Name
S22A1_HUMAN

NCBI Description

Polyspecific organic cation transporters in the liver, kidney, intestine, and other organs are critical for elimination of many endogenous small organic cations as well as a wide array of drugs and environmental toxins. This gene is one of three similar cation transporter genes located in a cluster on chromosome 6. The encoded protein contains twelve putative transmembrane domains and is a plasma integral membrane protein. Two transcript variants encoding two different isoforms have been found for this gene, but only the longer variant encodes a functional transporter. [provided by RefSeq, Jul 2008]

Uniprot Description

SLC22A1: Translocates a broad array of organic cations with various structures and molecular weights including the model compounds 1-methyl-4-phenylpyridinium (MPP), tetraethylammonium (TEA), N-1-methylnicotinamide (NMN), 4-(4-(dimethylamino)styryl)- N-methylpyridinium (ASP), the endogenous compounds choline, guanidine, histamine, epinephrine, adrenaline, noradrenaline and dopamine, and the drugs quinine, and metformin. The transport of organic cations is inhibited by a broad array of compounds like tetramethylammonium (TMA), cocaine, lidocaine, NMDA receptor antagonists, atropine, prazosin, cimetidine, TEA and NMN, guanidine, cimetidine, choline, procainamide, quinine, tetrabutylammonium, and tetrapentylammonium. Translocates organic cations in an electrogenic and pH-independent manner. Translocates organic cations across the plasma membrane in both directions. Transports the polyamines spermine and spermidine. Transports pramipexole across the basolateral membrane of the proximal tubular epithelial cells. The choline transport is activated by MMTS. Regulated by various intracellular signaling pathways including inhibition by protein kinase A activation, and endogenously activation by the calmodulin complex, the calmodulin- dependent kinase II and LCK tyrosine kinase. Belongs to the major facilitator (TC 2.A.1) superfamily. Organic cation transporter (TC 2.A.1.19) family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Transporter, SLC family; Transporter; Membrane protein, integral; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 6q25.3

Cellular Component: membrane; basolateral plasma membrane; integral to plasma membrane; plasma membrane

Molecular Function: protein binding; protein homodimerization activity; acetylcholine transmembrane transporter activity; norepinephrine transmembrane transporter activity; organic cation transmembrane transporter activity; secondary active organic cation transmembrane transporter activity; dopamine transmembrane transporter activity; quaternary ammonium group transmembrane transporter activity

Biological Process: dopamine transport; epinephrine transport; norepinephrine transport; organic cation transport; quaternary ammonium group transport; neurotransmitter transport; multidrug transport; establishment and/or maintenance of transmembrane electrochemical gradient; transmembrane transport; protein homooligomerization

Research Articles on SLC22A1

Similar Products

Product Notes

The SLC22A1 slc22a1 (Catalog #AAA3205954) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SLC22A1 antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SLC22A1 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the SLC22A1 slc22a1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: IAIQMICLVN AELYPTFVSG VGPACRGSDA TSSRDQGGRF ARDHEGRREP. It is sometimes possible for the material contained within the vial of "SLC22A1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.