Rabbit FGA Polyclonal Antibody | anti-FGA antibody

FGA antibody - N-terminal region

Cat. Num. AAA3206020

• Gene Names: FGA; Fib2
• Reactivity: Cow, Dog, Goat, Horse, Human, Mouse, Pig, Rat, Sheep
• Applications: Immunohistochemistry, Western Blot
• Purity: Protein A purified
• Synonyms: FGA; Polyclonal Antibody; FGA antibody - N-terminal region; anti-FGA antibody

• Host: Rabbit
• Reactivity: Cow, Dog, Goat, Horse, Human, Mouse, Pig, Rat, Sheep
• Clonality: Polyclonal
• Purity/Purification: Protein A purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: MFSMRIVCLVLSVVGTAWTADSGEGDFLAEGGGVRGPRVVERHQSACKDS
• Sequence Length: 644

• Applicable Applications for anti-FGA antibody: Immunohistochemistry (IHC), Western Blot (WB)
• Homology: Cow: 93%; Dog: 86%; Goat: 91%; Horse: 85%; Human: 100%; Mouse: 86%; Pig: 93%; Rat: 91%; Sheep: 91%
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FGA
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Rabbit Anti-FGA AntibodyParaffin Embedded Tissue: Human SkinCellular Data: Squamous epithelial cellsAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

Western Blot (WB)

(WB Suggested Anti-FGA Antibody Titration: 5.0ug/mlPositive Control: Jurkat cell lysate)

Related Product Information for anti-FGA antibody

This is a rabbit polyclonal antibody against FGA. It was validated on Western Blot and immunohistochemistry

Target Description: FGA is the alpha component of fibrinogen, a blood-borne glycoprotein comprised of three pairs of nonidentical polypeptide chains. Following vascular injury, fibrinogen is cleaved by thrombin to form fibrin which is the most abundant component of blood clots. In addition, various cleavage products of fibrinogen and fibrin regulate cell adhesion and spreading, display vasoconstrictor and chemotactic activities, and are mitogens for several cell types. Mutations in its gene lead to several disorders, including dysfibrinogenemia, hypofibrinogenemia, afibrinogenemia and renal amyloidosis.The protein encoded by this gene is the alpha component of fibrinogen, a blood-borne glycoprotein comprised of three pairs of nonidentical polypeptide chains. Following vascular injury, fibrinogen is cleaved by thrombin to form fibrin which is the most abundant component of blood clots. In addition, various cleavage products of fibrinogen and fibrin regulate cell adhesion and spreading, display vasoconstrictor and chemotactic activities, and are mitogens for several cell types. Mutations in this gene lead to several disorders, including dysfibrinogenemia, hypofibrinogenemia, afibrinogenemia and renal amyloidosis. Alternative splicing results in two isoforms which vary in the carboxy-terminus.

Product Categories/Family for anti-FGA antibody

Polyclonal; Signal Proteins; Cardiovascular; Disease Related; Tissue Specific & Cell Marker; Immunohistochemistry

NCBI and Uniprot Product Information

• NCBI GI #: 11761629
• NCBI GeneID: 2243
• NCBI Accession #: NP_068657
• NCBI GenBank Nucleotide #: NM_021871
• UniProt Accession #: Q4QQH7; P02671
• Molecular Weight: 71kDa
• NCBI Official Full Name: fibrinogen alpha chain isoform alpha
• NCBI Official Synonym Full Names: fibrinogen alpha chain
• NCBI Official Symbol: FGA
• NCBI Official Synonym Symbols: Fib2
• NCBI Protein Information: fibrinogen alpha chain
• Protein Family: Fibrinogen

NCBI Description

This gene encodes the alpha subunit of the coagulation factor fibrinogen, which is a component of the blood clot. Following vascular injury, the encoded preproprotein is proteolytically processed by thrombin during the conversion of fibrinogen to fibrin. Mutations in this gene lead to several disorders, including dysfibrinogenemia, hypofibrinogenemia, afibrinogenemia and renal amyloidosis. Alternative splicing results in multiple transcript variants, at least one of which encodes an isoform that undergoes proteolytic processing. [provided by RefSeq, Jan 2016]