Immunohistochemistry (IHC)
(Rabbit Anti-CTDSPL AntibodyParaffin Embedded Tissue: Human KidneyCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)
Rabbit CTDSPL Polyclonal Antibody | anti-CTDSPL antibody
CTDSPL antibody - N-terminal region
Gene Names
CTDSPL; PSR1; SCP3; HYA22; RBSP3; C3orf8
Reactivity
Human, Mouse, Pig, Rat, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
CTDSPL; Polyclonal Antibody; CTDSPL antibody - N-terminal region; anti-CTDSPL antibody
Host
Rabbit
Reactivity
Human, Mouse, Pig, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: CCFRDYNVEAPPPSSPSVLPPLVEENGGLQKPPAKYLLPEVTVLDYGKKC
Sequence Length
265
Applicable Applications for anti-CTDSPL antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Zebrafish: 90%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human CTDSPL
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Immunohistochemistry (IHC)
(Rabbit Anti-CTDSPL AntibodyParaffin Embedded Tissue: Human KidneyCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)
Immunohistochemistry (IHC)
(Rabbit Anti-CTDSPL AntibodyParaffin Embedded Tissue: Human KidneyCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)
Western Blot (WB)
(Host: RabbitTarget Name: CTDSPLSample Tissue: Human Fetal LiverAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: CTDSPLSample Tissue: Human Fetal LiverAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(WB Suggested Anti-CTDSPL Antibody Titration: 0.2-1 ug/mlPositive Control: DLD1 cell lysateCTDSPL is strongly supported by BioGPS gene expression data to be expressed in Human DLD1 cells)
Western Blot (WB)
(WB Suggested Anti-CTDSPL Antibody Titration: 0.2-1 ug/mlPositive Control: DLD1 cell lysateCTDSPL is strongly supported by BioGPS gene expression data to be expressed in Human DLD1 cells)
Related Product Information for anti-CTDSPL antibody
This is a rabbit polyclonal antibody against CTDSPL. It was validated on Western Blot and immunohistochemistry
Target Description: CTDSPL may function as a phosphatase involved in the regulation of cell growth and differentiation.
Target Description: CTDSPL may function as a phosphatase involved in the regulation of cell growth and differentiation.
Product Categories/Family for anti-CTDSPL antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
30kDa
NCBI Official Full Name
CTD small phosphatase-like protein isoform 2
NCBI Official Synonym Full Names
CTD small phosphatase like
NCBI Official Symbol
CTDSPL
NCBI Official Synonym Symbols
PSR1; SCP3; HYA22; RBSP3; C3orf8
NCBI Protein Information
CTD small phosphatase-like protein
Protein Family
Research Articles on CTDSPL
Similar Products
Product Notes
The CTDSPL (Catalog #AAA3206278) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CTDSPL antibody - N-terminal region reacts with Human, Mouse, Pig, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's CTDSPL can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the CTDSPL for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: CCFRDYNVEA PPPSSPSVLP PLVEENGGLQ KPPAKYLLPE VTVLDYGKKC. It is sometimes possible for the material contained within the vial of "CTDSPL, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
