Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-TCEB1 Antibody Titration: 0.2-1 ug/mlPositive Control: Raji cell lysateTCEB1 is strongly supported by BioGPS gene expression data to be expressed in Human Raji cells)

Rabbit ELOC Polyclonal Antibody | anti-ELOC antibody

ELOC Antibody - N-terminal region

Gene Names
ELOC; SIII; TCEB1
Reactivity
Dog, Human, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ELOC; Polyclonal Antibody; ELOC Antibody - N-terminal region; anti-ELOC antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Human, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMYFTYKVRY
Sequence Length
112
Applicable Applications for anti-ELOC antibody
Western Blot (WB)
Homology
Dog: 100%; Human: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human TCEB1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-TCEB1 Antibody Titration: 0.2-1 ug/mlPositive Control: Raji cell lysateTCEB1 is strongly supported by BioGPS gene expression data to be expressed in Human Raji cells)

Western Blot (WB) (WB Suggested Anti-TCEB1 Antibody Titration: 0.2-1 ug/mlPositive Control: Raji cell lysateTCEB1 is strongly supported by BioGPS gene expression data to be expressed in Human Raji cells)
Related Product Information for anti-ELOC antibody
This is a rabbit polyclonal antibody against TCEB1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: This gene encodes the protein elongin C, which is a subunit of the transcription factor B (SIII) complex. The SIII complex is composed of elongins A/A2, B and C. It activates elongation by RNA polymerase II by suppressing transient pausing of the polymerase at many sites within transcription units. Elongin A functions as the transcriptionally active component of the SIII complex, whereas elongins B and C are regulatory subunits. Elongin A2 is specifically expressed in the testis, and capable of forming a stable complex with elongins B and C. The von Hippel-Lindau tumor suppressor protein binds to elongins B and C, and thereby inhibits transcription elongation. Multiple alternatively spliced transcript variants encoding two distinct isoforms have been identified.
Product Categories/Family for anti-ELOC antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
12kDa
NCBI Official Full Name
elongin-C isoform a
NCBI Official Synonym Full Names
elongin C
NCBI Official Symbol
ELOC
NCBI Official Synonym Symbols
SIII; TCEB1
NCBI Protein Information
elongin-C
UniProt Protein Name
Transcription elongation factor B polypeptide 1
UniProt Gene Name
TCEB1
UniProt Synonym Gene Names
EloC
UniProt Entry Name
ELOC_HUMAN

NCBI Description

This gene encodes the protein elongin C, which is a subunit of the transcription factor B (SIII) complex. The SIII complex is composed of elongins A/A2, B and C. It activates elongation by RNA polymerase II by suppressing transient pausing of the polymerase at many sites within transcription units. Elongin A functions as the transcriptionally active component of the SIII complex, whereas elongins B and C are regulatory subunits. Elongin A2 is specifically expressed in the testis, and capable of forming a stable complex with elongins B and C. The von Hippel-Lindau tumor suppressor protein binds to elongins B and C, and thereby inhibits transcription elongation. Multiple alternatively spliced transcript variants encoding two distinct isoforms have been identified. [provided by RefSeq, Mar 2011]

Uniprot Description

TCEB1: SIII, also known as elongin, is a general transcription elongation factor that increases the RNA polymerase II transcription elongation past template-encoded arresting sites. Subunit A is transcriptionally active and its transcription activity is strongly enhanced by binding to the dimeric complex of the SIII regulatory subunits B and C (elongin BC complex). Belongs to the SKP1 family.

Protein type: Transcription initiation complex

Chromosomal Location of Human Ortholog: 8q21.11

Cellular Component: nucleoplasm; VCB complex; cytosol

Molecular Function: protein binding; protein complex binding

Biological Process: transcription from RNA polymerase II promoter; ubiquitin-dependent protein catabolic process; regulation of transcription from RNA polymerase II promoter; viral reproduction; positive regulation of viral transcription; positive regulation of RNA elongation from RNA polymerase II promoter; RNA elongation from RNA polymerase II promoter; gene expression

Research Articles on ELOC

Similar Products

Product Notes

The ELOC tceb1 (Catalog #AAA3224696) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ELOC Antibody - N-terminal region reacts with Dog, Human, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's ELOC can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ELOC tceb1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EHALTSGTIK AMLSGPGQFA ENETNEVNFR EIPSHVLSKV CMYFTYKVRY. It is sometimes possible for the material contained within the vial of "ELOC, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.