Western Blot (WB)
(Western Blot analysis of PCBD2 expression in transfected 293T cell line by PCBD2 polyclonal antibody. Lane 1: PCBD2 transfected lysate (14.19kD). Lane 2: Non-transfected lysate.)
Mouse anti-Human PCBD2 Polyclonal Antibody | anti-PCBD2 antibody
PCBD2 (Pterin-4-alpha-carbinolamine Dehydratase 2, PHS 2, 4-alpha-hydroxy-tetrahydropterin Dehydratase 2, DcoH-like Protein DCoHm, Dimerization Cofactor of Hepatocyte Nuclear Factor 1 from Muscle, HNF-1-alpha Dimerization Cofactor, DCOH2, DCOHM)
Gene Names
PCBD2; DCOHM
Reactivity
Human
Applications
Western Blot
Purity
Affinity PurifiedPurified by Protein A affinity chromatography.
Synonyms
PCBD2; Polyclonal Antibody; PCBD2 (Pterin-4-alpha-carbinolamine Dehydratase 2; PHS 2; 4-alpha-hydroxy-tetrahydropterin Dehydratase 2; DcoH-like Protein DCoHm; Dimerization Cofactor of Hepatocyte Nuclear Factor 1 from Muscle; HNF-1-alpha Dimerization Cofactor; DCOH2; DCOHM); Anti -PCBD2 (Pterin-4-alpha-carbinolamine Dehydratase 2; anti-PCBD2 antibody
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human PCBD2.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MAAVLGALGATRRLLAALRGQSLGLAAMSSGTHRLTAEERNQAILDLKAAGWSELSERDAIYKEFSFHNFNQAFGFMSRVALQAEKMNHHPEWFNVYNVQITLTSHDCGELTKKDVKLAKFIEKAAASV
Applicable Applications for anti-PCBD2 antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human PCBD2, aa1-129 (NP_115527.2).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot analysis of PCBD2 expression in transfected 293T cell line by PCBD2 polyclonal antibody. Lane 1: PCBD2 transfected lysate (14.19kD). Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of PCBD2 expression in transfected 293T cell line by PCBD2 polyclonal antibody. Lane 1: PCBD2 transfected lysate (14.19kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-PCBD2 antibody
PCBD2 belongs to the pterin-4-alpha-carbinolamine dehydratase family. It is involved in tetrahydrobiopterin biosynthesis. It both prevents the formation of 7-pterins and accelerates the formation of quinonoid-BH2. PCBD2 regulates the dimerization of homeodomain protein HNF-1-alpha and enhances its transcriptional activity.
Product Categories/Family for anti-PCBD2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
11,768 Da
NCBI Official Full Name
pterin-4-alpha-carbinolamine dehydratase 2
NCBI Official Synonym Full Names
pterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha (TCF1) 2
NCBI Official Symbol
PCBD2
NCBI Official Synonym Symbols
DCOHM
NCBI Protein Information
pterin-4-alpha-carbinolamine dehydratase 2; PHS 2; DCoH-alpha; dcoH-like protein DCoHm; 4-alpha-hydroxy-tetrahydropterin dehydratase 2; hepatocyte nuclear factor 1a dimerization cofactor isoform; dimerization cofactor of hepatocyte nuclear factor 1 (HNF1) from muscle; 6-pyruvoyl-tetrahydropterin synthase/dimerization cofactor of hepatocyte nuclear factor 1 alpha (TCF1) 2
UniProt Protein Name
Pterin-4-alpha-carbinolamine dehydratase 2
Protein Family
UniProt Gene Name
PCBD2
UniProt Synonym Gene Names
DCOHM; PHS 2
UniProt Entry Name
PHS2_CHICK
Uniprot Description
Function: Involved in tetrahydrobiopterin biosynthesis. Seems to both prevent the formation of 7-pterins and accelerate the formation of quinonoid-BH2
By similarity.Regulates the dimerization of homeodomain protein HNF-1-alpha and enhances its transcriptional activity.
Catalytic activity: (6R)-6-(L-erythro-1,2-dihydroxypropyl)-5,6,7,8-tetrahydro-4a-hydroxypterin = (6R)-6-(L-erythro-1,2-dihydroxypropyl)-7,8-dihydro-6H-pterin + H2O.
Tissue specificity: Highest level found in the kidney, liver, heart and ovarian follicles.
Sequence similarities: Belongs to the pterin-4-alpha-carbinolamine dehydratase family.
Similar Products
Product Notes
The PCBD2 pcbd2 (Catalog #AAA6013508) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PCBD2 (Pterin-4-alpha-carbinolamine Dehydratase 2, PHS 2, 4-alpha-hydroxy-tetrahydropterin Dehydratase 2, DcoH-like Protein DCoHm, Dimerization Cofactor of Hepatocyte Nuclear Factor 1 from Muscle, HNF-1-alpha Dimerization Cofactor, DCOH2, DCOHM) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PCBD2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the PCBD2 pcbd2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MAAVLGALGA TRRLLAALRG QSLGLAAMSS GTHRLTAEER NQAILDLKAA GWSELSERDA IYKEFSFHNF NQAFGFMSRV ALQAEKMNHH PEWFNVYNVQ ITLTSHDCGE LTKKDVKLAK FIEKAAASV. It is sometimes possible for the material contained within the vial of "PCBD2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
