Rabbit anti-Human ELN Polyclonal Antibody | anti-ELN antibody

ELN (Elastin, Tropoelastin, FLJ38671, FLJ43523) (FITC)

Cat. Num. AAA6377286

• Gene Names: ELN; WS; WBS; SVAS; ADCL1
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: ELN; Polyclonal Antibody; ELN (Elastin; Tropoelastin; FLJ38671; FLJ43523) (FITC); anti-ELN antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human ELN.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein Isothiocyanate (FITC).
• Sequence Length: 3228

• Applicable Applications for anti-ELN antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full-length protein corresponding to aa1-658 of human ELN (BC065566.1; AAH65566.1).
• Immunogen Sequence: MAGLTAAAPRPGVLLLLLSILHPSRPGGVPGAIPGGVPGGVFYPGAGLGALGGGALGPGGKPLKPVPGGLAGAGLGAGLGAFPAVTFPGALVPGGVADAAAAYKAAKAGAGLGGVPGVGGLGVSAGAVVPQPGAGVKPGKVPGVGLPGVYPGGVLPGARFPGVGVLPGVPTGAGVKPKAPGVGGAFAGIPGVGPFGGPQPGVPLGYPIKAPKLPGYGPGGVAGAAGKAGYPTGTGVGPQAAAAAAAKAAAKFGAGAAGVLPGVGGAGVPGVPGAIPGIGGIAGVGTPAAAAAAAAAAKAAKYGAAAGLVPGGPGFGPGVVGVPGAGVPGVGVPGAGIPVVPGAGIPGAAVPGVVSPEAAAKAAAKAAKYGARPGVGVGGIPTYGVGAGGFPGFGVGVGGIPGVAGVPSVGGVPGVGGVPGVGISPEAQAAAAAKAAKYGLVPGVGVAPGVGVAPGVGVAPGVGLAPGVGVAPGVGVAPGVGVAPGIGPGGVAGAAAGLGAGIPGLGVGVGVPGLGVGAGVPGLGVGAGVPGFRAVPGALAAAKAAKYGAAVPGVLGGLGALGGVGIPGGVVGAGPAAAAAAAKAAAKAAQFGLVGAAGLGGLGVGGLGVPGVGGLGGIPPAAAAKAAKYGVAARPGFGLSPIFPGGACLGKACGRKRK
• Conjugate: FITC
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of ELN expression in transfected 293T cell line using 126293. Lane 1: ELN transfected lysate (56.7kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-ELN antibody

Elastin is the major extracellular matrix protein of large arteries such as the aorta, lung parenchyma, elastic ligaments and skin imparting characteristics of extensibility and elastic recoil. It is also the major matrix protein in some cartilaginous tissues such as ear cartilage, where the functional role of this protein is less evident. It is found throughout the vertebrate kingdom except for primitive fish. Once laid down in tissues, polymeric elastin is able to sustain its mechanical resilience through thousands of millions of cycles of extension and recoil. Elastin is usually synthesized as a monomer, tropoelastin, which is subsequently assembled into a stable, polymeric structure in the extracellular matrix. This polymer is stabilized by covalent cross-links formed through interactions between side chains of lysine residues after oxidative deamination by lysyl oxidase. The protein also consists of 36 domains with alternating hydrophobic and cross-linking characteristics. The hydrophobic domains, predominantly containing glycine, proline, leucine and valine, are responsible for the ability of elastin to align monomeric chains for covalent cross-linking. Defects in elastin are the cause of disorders like autosomal dominant cutis laxa, Williams-Beuren syndrome and supravalvular aortic stenosis.

Product Categories/Family for anti-ELN antibody

Antibodies; Elastin

NCBI and Uniprot Product Information

• NCBI GI #: 41388840
• NCBI GeneID: 2006
• NCBI Official Full Name: Homo sapiens elastin, mRNA
• NCBI Official Synonym Full Names: elastin
• NCBI Official Symbol: ELN
• NCBI Official Synonym Symbols: WS; WBS; SVAS; ADCL1
• NCBI Protein Information: elastin
• Protein Family: Elastin

NCBI Description

This gene encodes a protein that is one of the two components of elastic fibers. Elastic fibers comprise part of the extracellular matrix and confer elasticity to organs and tissues including the heart, skin, lungs, ligaments, and blood vessels. The encoded protein is rich in hydrophobic amino acids such as glycine and proline, which form mobile hydrophobic regions bounded by crosslinks between lysine residues. Degradation products of the encoded protein, known as elastin-derived peptides or elastokines, bind the elastin receptor complex and other receptors and stimulate migration and proliferation of monocytes and skin fibroblasts. Elastokines can also contribute to cancer progression. Deletions and mutations in this gene are associated with supravalvular aortic stenosis (SVAS) and autosomal dominant cutis laxa. [provided by RefSeq, Aug 2017]