Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of ELN expression in transfected 293T cell line using 126293. Lane 1: ELN transfected lysate (56.7kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human ELN Polyclonal Antibody | anti-ELN antibody

ELN (Elastin, Tropoelastin, FLJ38671, FLJ43523) (PE)

Gene Names
ELN; WS; WBS; SVAS; ADCL1
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ELN; Polyclonal Antibody; ELN (Elastin; Tropoelastin; FLJ38671; FLJ43523) (PE); anti-ELN antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human ELN.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Sequence Length
3228
Applicable Applications for anti-ELN antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full-length protein corresponding to aa1-658 of human ELN (BC065566.1; AAH65566.1).
Immunogen Sequence
MAGLTAAAPRPGVLLLLLSILHPSRPGGVPGAIPGGVPGGVFYPGAGLGALGGGALGPGGKPLKPVPGGLAGAGLGAGLGAFPAVTFPGALVPGGVADAAAAYKAAKAGAGLGGVPGVGGLGVSAGAVVPQPGAGVKPGKVPGVGLPGVYPGGVLPGARFPGVGVLPGVPTGAGVKPKAPGVGGAFAGIPGVGPFGGPQPGVPLGYPIKAPKLPGYGPGGVAGAAGKAGYPTGTGVGPQAAAAAAAKAAAKFGAGAAGVLPGVGGAGVPGVPGAIPGIGGIAGVGTPAAAAAAAAAAKAAKYGAAAGLVPGGPGFGPGVVGVPGAGVPGVGVPGAGIPVVPGAGIPGAAVPGVVSPEAAAKAAAKAAKYGARPGVGVGGIPTYGVGAGGFPGFGVGVGGIPGVAGVPSVGGVPGVGGVPGVGISPEAQAAAAAKAAKYGLVPGVGVAPGVGVAPGVGVAPGVGLAPGVGVAPGVGVAPGVGVAPGIGPGGVAGAAAGLGAGIPGLGVGVGVPGLGVGAGVPGLGVGAGVPGFRAVPGALAAAKAAKYGAAVPGVLGGLGALGGVGIPGGVVGAGPAAAAAAAKAAAKAAQFGLVGAAGLGGLGVGGLGVPGVGGLGGIPPAAAAKAAKYGVAARPGFGLSPIFPGGACLGKACGRKRK
Conjugate
PE
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of ELN expression in transfected 293T cell line using 126293. Lane 1: ELN transfected lysate (56.7kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of ELN expression in transfected 293T cell line using 126293. Lane 1: ELN transfected lysate (56.7kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-ELN antibody
Elastin is the major extracellular matrix protein of large arteries such as the aorta, lung parenchyma, elastic ligaments and skin imparting characteristics of extensibility and elastic recoil. It is also the major matrix protein in some cartilaginous tissues such as ear cartilage, where the functional role of this protein is less evident. It is found throughout the vertebrate kingdom except for primitive fish. Once laid down in tissues, polymeric elastin is able to sustain its mechanical resilience through thousands of millions of cycles of extension and recoil. Elastin is usually synthesized as a monomer, tropoelastin, which is subsequently assembled into a stable, polymeric structure in the extracellular matrix. This polymer is stabilized by covalent cross-links formed through interactions between side chains of lysine residues after oxidative deamination by lysyl oxidase. The protein also consists of 36 domains with alternating hydrophobic and cross-linking characteristics. The hydrophobic domains, predominantly containing glycine, proline, leucine and valine, are responsible for the ability of elastin to align monomeric chains for covalent cross-linking. Defects in elastin are the cause of disorders like autosomal dominant cutis laxa, Williams-Beuren syndrome and supravalvular aortic stenosis.
Product Categories/Family for anti-ELN antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
Homo sapiens elastin, mRNA
NCBI Official Synonym Full Names
elastin
NCBI Official Symbol
ELN
NCBI Official Synonym Symbols
WS; WBS; SVAS; ADCL1
NCBI Protein Information
elastin
Protein Family

NCBI Description

This gene encodes a protein that is one of the two components of elastic fibers. Elastic fibers comprise part of the extracellular matrix and confer elasticity to organs and tissues including the heart, skin, lungs, ligaments, and blood vessels. The encoded protein is rich in hydrophobic amino acids such as glycine and proline, which form mobile hydrophobic regions bounded by crosslinks between lysine residues. Degradation products of the encoded protein, known as elastin-derived peptides or elastokines, bind the elastin receptor complex and other receptors and stimulate migration and proliferation of monocytes and skin fibroblasts. Elastokines can also contribute to cancer progression. Deletions and mutations in this gene are associated with supravalvular aortic stenosis (SVAS) and autosomal dominant cutis laxa. [provided by RefSeq, Aug 2017]

Research Articles on ELN

Similar Products

Product Notes

The ELN (Catalog #AAA6377293) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ELN (Elastin, Tropoelastin, FLJ38671, FLJ43523) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ELN can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ELN for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ELN, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.