Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-ELA1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:2500Positive Control: HepG2 cell lysate)

Rabbit ELA1 Polyclonal Antibody | anti-CELA1 antibody

ELA1 antibody - N-terminal region

Gene Names
CELA1; ELA1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ELA1; Polyclonal Antibody; ELA1 antibody - N-terminal region; anti-CELA1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LVLYGHSTQDLPETNARVVGGTEAGRNSWPSQISLQYRSGGSRYHTCGGT
Sequence Length
258
Applicable Applications for anti-CELA1 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 92%; Human: 100%; Mouse: 77%; Rabbit: 93%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human ELA1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-ELA1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:2500Positive Control: HepG2 cell lysate)

Western Blot (WB) (WB Suggested Anti-ELA1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:2500Positive Control: HepG2 cell lysate)
Related Product Information for anti-CELA1 antibody
This is a rabbit polyclonal antibody against ELA1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Elastases form a subfamily of serine proteases that hydrolyze many proteins in addition to elastin. Humans have six structurally similar proteins elastase 1, 2, 2A, 2B, 3A, and 3B. Unlike other elastases, pancreatic elastase 1 is not expressed in the pancreas. To date, elastase 1 (ELA1) expression has only been detected in skin keratinocytes. Clinical literature that describes human elastase 1 activity in the pancreas is actually referring to elastase 2A.Elastases form a subfamily of serine proteases that hydrolyze many proteins in addition to elastin. Humans have six elastase genes which encode the structurally similar proteins elastase 1, 2, 2A, 2B, 3A, and 3B. Unlike other elastases, pancreatic elastase 1 is not expressed in the pancreas. To date, elastase 1 expression has only been detected in skin keratinocytes. Clinical literature that describes human elastase 1 activity in the pancreas is actually referring to elastase 2A. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-867 BC069454.1 1-867 868-952 AF120493.1 868-952
Product Categories/Family for anti-CELA1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28kDa
NCBI Official Full Name
chymotrypsin-like elastase family member 1
NCBI Official Synonym Full Names
chymotrypsin like elastase family member 1
NCBI Official Symbol
CELA1
NCBI Official Synonym Symbols
ELA1
NCBI Protein Information
chymotrypsin-like elastase family member 1
UniProt Protein Name
Chymotrypsin-like elastase family member 1
UniProt Gene Name
CELA1
UniProt Synonym Gene Names
ELA1
UniProt Entry Name
CELA1_HUMAN

NCBI Description

Elastases form a subfamily of serine proteases that hydrolyze many proteins in addition to elastin. Humans have six elastase genes which encode the structurally similar proteins elastase 1, 2, 2A, 2B, 3A, and 3B. Unlike other elastases, pancreatic elastase 1 is not expressed in the pancreas. To date, elastase 1 expression has only been detected in skin keratinocytes. Clinical literature that describes human elastase 1 activity in the pancreas or fecal material is actually referring to chymotrypsin-like elastase family, member 3B. [provided by RefSeq, May 2009]

Uniprot Description

CELA1: Acts upon elastin. Belongs to the peptidase S1 family. Elastase subfamily.

Protein type: Protease; Secreted; Secreted, signal peptide; EC 3.4.21.36

Chromosomal Location of Human Ortholog: 12q13

Cellular Component: extracellular region

Molecular Function: metal ion binding; serine-type endopeptidase activity

Biological Process: Wnt receptor signaling pathway; multicellular organism growth; regulation of cell differentiation; exocrine pancreas development; positive regulation of transcription from RNA polymerase II promoter; negative regulation of transcription from RNA polymerase II promoter; proteolysis; inflammatory response; regulation of cell proliferation; post-embryonic development

Research Articles on CELA1

Similar Products

Product Notes

The CELA1 cela1 (Catalog #AAA3210555) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ELA1 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ELA1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CELA1 cela1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LVLYGHSTQD LPETNARVVG GTEAGRNSWP SQISLQYRSG GSRYHTCGGT. It is sometimes possible for the material contained within the vial of "ELA1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.