Rabbit anti-Human EIF5A Polyclonal Antibody | anti-EIF5A antibody

EIF5A Antibody - C-terminal region

Cat. Num. AAA3219483

• Gene Names: EIF5A; EIF-5A; EIF5A1; eIF5AI
• Reactivity: Human
• Applications: Western Blot
• Purity: Affinity Purified
• Synonyms: EIF5A; Polyclonal Antibody; EIF5A Antibody - C-terminal region; anti-EIF5A antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Purity/Purification: Affinity Purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: LLQDSGEVREDLRLPEGDLGKEIEQKYDCGEEILITVLSAMTEEAAVAIK
• Sequence Length: 184

• Applicable Applications for anti-EIF5A antibody: Western Blot (WB)
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human IF5A1
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: IF5A1Sample Type: 721_B Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Related Product Information for anti-EIF5A antibody

This is a rabbit polyclonal antibody against IF5A1. It was validated on Western Blot

Product Categories/Family for anti-EIF5A antibody

Polyclonal; Neurobiology; Developmental Biology; Immunology; Apoptosis; Disease Related; DNA/RNA/Protein Interactions; Meiosis/Mitosis/Cell Cycle

NCBI and Uniprot Product Information

• NCBI GI #: 54037409
• NCBI GeneID: 1984
• UniProt Accession #: P63241
• Molecular Weight: 20kDa
• NCBI Official Full Name: Eukaryotic translation initiation factor 5A-1
• NCBI Official Synonym Full Names: eukaryotic translation initiation factor 5A
• NCBI Official Symbol: EIF5A
• NCBI Official Synonym Symbols: EIF-5A; EIF5A1; eIF5AI
• NCBI Protein Information: eukaryotic translation initiation factor 5A-1
• UniProt Protein Name: Eukaryotic translation initiation factor 5A-1
• Protein Family: Translation initiation factor
• UniProt Gene Name: EIF5A
• UniProt Synonym Gene Names: eIF-5A-1; eIF-5A1; eIF-5A
• UniProt Entry Name: IF5A1_HUMAN

Uniprot Description

EIF5A: mRNA-binding protein involved in translation elongation. Has an important function at the level of mRNA turnover, probably acting downstream of decapping. Involved in actin dynamics and cell cycle progression, mRNA decay and probably in a pathway involved in stress response and maintenance of cell wall integrity. With syntenin SDCBP, functions as a regulator of p53/TP53 and p53/TP53-dependent apoptosis. Regulates also TNF- alpha-mediated apoptosis. Mediates effects of polyamines on neuronal process extension and survival. May play an important role in brain development and function, and in skeletal muscle stem cell differentiation. Also described as a cellular cofactor of human T-cell leukemia virus type I (HTLV-1) Rex protein and of human immunodeficiency virus type 1 (HIV-1) Rev protein, essential for mRNA export of retroviral transcripts. Belongs to the eIF-5A family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Translation initiation; Translation

Chromosomal Location of Human Ortholog: 17p13-p12

Cellular Component: endoplasmic reticulum membrane; membrane; cytoplasm; nuclear pore; cytosol; nucleus; annulate lamellae

Molecular Function: protein binding; RNA binding; ribosome binding; protein N-terminus binding; translation elongation factor activity; U6 snRNA binding

Biological Process: mRNA export from nucleus; translational frameshifting; cellular protein metabolic process; apoptosis; positive regulation of cell proliferation; nucleocytoplasmic transport; positive regulation of translational elongation; hypusine biosynthetic process from peptidyl-lysine; protein export from nucleus; post-translational protein modification; positive regulation of translational termination