Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (EIF3S4 antibody (MBS839384) used at 1.25 ug/ml to detect target protein.)

Rabbit EIF3S4 Polyclonal Antibody | anti-EIF3S4 antibody

EIF3S4 antibody

Reactivity
Human, Mouse, Rat, Dog
Applications
Western Blot, Immunohistochemistry
Purity
Total IgG Protein A purified
Synonyms
EIF3S4; Polyclonal Antibody; EIF3S4 antibody; Polyclonal EIF3S4; Anti-EIF3S4; Eukaryotic Translation Initiation Factor 3 Subunit 4 Delta 44Kda; EIFS4 3; EIFS4-3; anti-EIF3S4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat, Dog
Clonality
Polyclonal
Specificity
EIF3S4 antibody was raised against the N terminal of EIF3S4
Purity/Purification
Total IgG Protein A purified
Form/Format
Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of EIF3S4 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Applicable Applications for anti-EIF3S4 antibody
Western Blot (WB), Immunohistochemistry (IHC)
Application Notes
WB: 1.25 ug/ml
IHC: 4-8 ug/ml
Biological Significance
EIF3S4 contains 1 RRM (RNA recognition motif) domain. It binds to the 40S ribosome and promotes the binding of methionyl-tRNAi and mRNA. This subunit binds to the 18S rRNA.
Cross-Reactivity
Human,Mouse,Rat,Dog
Immunogen
EIF3S4 antibody was raised using the N terminal of EIF3S4 corresponding to a region with amino acids SPEPELLPGAPLPPPKEVINGNIKTVTEYKIDEDGKKFKIVRTFRIETRK
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(EIF3S4 antibody (MBS839384) used at 1.25 ug/ml to detect target protein.)

Western Blot (WB) (EIF3S4 antibody (MBS839384) used at 1.25 ug/ml to detect target protein.)
Related Product Information for anti-EIF3S4 antibody
Rabbit polyclonal EIF3S4 antibody raised against the N terminal of EIF3S4
Product Categories/Family for anti-EIF3S4 antibody

Similar Products

Product Notes

The EIF3S4 (Catalog #AAA839384) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The EIF3S4 antibody reacts with Human, Mouse, Rat, Dog and may cross-react with other species as described in the data sheet. AAA Biotech's EIF3S4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC). WB: 1.25 ug/ml IHC: 4-8 ug/ml. Researchers should empirically determine the suitability of the EIF3S4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "EIF3S4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.