Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (HNRPA1 antibody (MBS839728) used at 1.25 ug/ml to detect target protein.)

Rabbit HNRPA1 Polyclonal Antibody | anti-HNRPA1 antibody

HNRPA1 antibody

Gene Names
HNRNPA1; ALS19; ALS20; HNRPA1; IBMPFD3; HNRPA1L3; hnRNP A1; hnRNP-A1
Applications
Western Blot, Immunohistochemistry
Purity
Total IgG Protein A purified
Synonyms
HNRPA1; Polyclonal Antibody; HNRPA1 antibody; Polyclonal HNRPA1; Anti-HNRPA1; HNRPA-1; Heterogeneous Nuclear Ribonucleoprotein A1; HNRPA 1; anti-HNRPA1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Clonality
Polyclonal
Specificity
HNRPA1 antibody was raised against the N terminal of HNRPA1
Purity/Purification
Total IgG Protein A purified
Form/Format
Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of HNRPA1 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
372
Applicable Applications for anti-HNRPA1 antibody
Western Blot (WB), Immunohistochemistry (IHC)
Application Notes
WB: 1.25 ug/ml
IHC: 4-8 ug/ml
Biological Significance
HNRPA1 belongs to the A/B subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). HNRPA1 has two repeats of quasi-RRM domains that bind to RNAs. It is one of the most abundant core proteins of hnRNP complexes and it is localized to the nucleoplasm. HNRPA1 is involved in the packaging of pre-mRNA into hnRNP particles, transport of poly A+ mRNA from the nucleus to the cytoplasm, and may modulate splice site selection. It is also thought have a primary role in the formation of specific myometrial protein species in parturition.
Cross-Reactivity
Human, Mouse, Rat, Dog
Immunogen
HNRPA1 antibody was raised using the N terminal of HNRPA1 corresponding to a region with amino acids MSKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPN
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(HNRPA1 antibody (MBS839728) used at 1.25 ug/ml to detect target protein.)

Western Blot (WB) (HNRPA1 antibody (MBS839728) used at 1.25 ug/ml to detect target protein.)

Immunohistochemistry (IHC)

(HNRPA1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Myocardial cells (arrows) in Human Head. Magnification is at 400X)

Immunohistochemistry (IHC) (HNRPA1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Myocardial cells (arrows) in Human Head. Magnification is at 400X)
Related Product Information for anti-HNRPA1 antibody
Rabbit polyclonal HNRPA1 antibody raised against the N terminal of HNRPA1
Product Categories/Family for anti-HNRPA1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
35 kDa (MW of target protein)
NCBI Official Full Name
heterogeneous nuclear ribonucleoprotein A1 isoform b
NCBI Official Synonym Full Names
heterogeneous nuclear ribonucleoprotein A1
NCBI Official Symbol
HNRNPA1
NCBI Official Synonym Symbols
ALS19; ALS20; HNRPA1; IBMPFD3; HNRPA1L3; hnRNP A1; hnRNP-A1
NCBI Protein Information
heterogeneous nuclear ribonucleoprotein A1
UniProt Protein Name
Heterogeneous nuclear ribonucleoprotein A1
UniProt Gene Name
HNRNPA1
UniProt Synonym Gene Names
HNRPA1; hnRNP A1
UniProt Entry Name
ROA1_HUMAN

NCBI Description

This gene belongs to the A/B subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has two repeats of quasi-RRM domains that bind to RNAs. It is one of the most abundant core proteins of hnRNP complexes and it is localized to the nucleoplasm. This protein, along with other hnRNP proteins, is exported from the nucleus, probably bound to mRNA, and is immediately re-imported. Its M9 domain acts as both a nuclear localization and nuclear export signal. The encoded protein is involved in the packaging of pre-mRNA into hnRNP particles, transport of poly A+ mRNA from the nucleus to the cytoplasm, and may modulate splice site selection. It is also thought have a primary role in the formation of specific myometrial protein species in parturition. Multiple alternatively spliced transcript variants have been found for this gene but only two transcripts are fully described. These variants have multiple alternative transcription initiation sites and multiple polyA sites. [provided by RefSeq, Jul 2008]

Uniprot Description

hnRNP A1: Involved in the packaging of pre-mRNA into hnRNP particles, transport of poly(A) mRNA from the nucleus to the cytoplasm and may modulate splice site selection. May play a role in HCV RNA replication. Identified in the spliceosome C complex. Identified in a mRNP granule complex, at least composed of ACTB, ACTN4, DHX9, ERG, HNRNPA1, HNRNPA2B1, HNRNPAB, HNRNPD, HNRNPL, HNRNPR, HNRNPU, HSPA1, HSPA8, IGF2BP1, ILF2, ILF3, NCBP1, NCL, PABPC1, PABPC4, PABPN1, RPLP0, RPS3, RPS3A, RPS4X, RPS8, RPS9, SYNCRIP, TROVE2, YBX1 and untranslated mRNAs. Interacts with SEPT6. Interacts with HCV NS5B and with the 5'-UTR and 3'-UTR of HCV RNA. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Spliceosome; RNA splicing; Nuclear export; RNA-binding

Chromosomal Location of Human Ortholog: 12q13.1

Cellular Component: nucleoplasm; spliceosome; intermediate filament cytoskeleton; membrane; cytoplasm; ribonucleoprotein complex

Molecular Function: protein binding; single-stranded RNA binding; RNA binding; nucleotide binding; single-stranded DNA binding

Biological Process: nuclear mRNA splicing, via spliceosome; mRNA transport; viral reproduction; RNA export from nucleus; RNA splicing; nuclear export; nuclear import; gene expression; mRNA processing

Disease: Amyotrophic Lateral Sclerosis 20; Inclusion Body Myopathy With Early-onset Paget Disease With Or Without Frontotemporal Dementia 3

Research Articles on HNRPA1

Similar Products

Product Notes

The HNRPA1 hnrnpa1 (Catalog #AAA839728) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's HNRPA1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC). WB: 1.25 ug/ml IHC: 4-8 ug/ml. Researchers should empirically determine the suitability of the HNRPA1 hnrnpa1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HNRPA1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.