Western Blot (WB)
(C14ORF130 antibody (MBS5301656) used at 1.25 ug/ml to detect target protein.)
Rabbit C14ORF130 Polyclonal Antibody | anti-C14ORF130 antibody
C14ORF130 antibody
Gene Names
UBR7; C14orf130
Reactivity
Human, Mouse, Rat, Dog
Applications
Western Blot, Immunohistochemistry
Purity
Total IgG Protein A purified
Synonyms
C14ORF130; Polyclonal Antibody; C14ORF130 antibody; Polyclonal C14ORF130; Anti-C14ORF130; Chromosome ORF 14; Chromosome 14 ORF; FLJ10483; Chromosome ORF-14; MGC9518; anti-C14ORF130 antibody
Host
Rabbit
Reactivity
Human, Mouse, Rat, Dog
Clonality
Polyclonal
Specificity
C14ORF130 antibody was raised against the C terminal Of C14Orf130
Purity/Purification
Total IgG Protein A purified
Form/Format
Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of C14ORF130 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
393
Applicable Applications for anti-C14ORF130 antibody
Western Blot (WB), Immunohistochemistry (IHC)
Application Notes
WB: 1.25 ug/ml
IHC: 4-8 ug/ml
IHC: 4-8 ug/ml
Biological Significance
The function of Chromosome 14 ORF protein is not widely studied, and is yet to be elucidated fully.
Cross-Reactivity
Human,Mouse,Rat,Dog
Immunogen
C14ORF130 antibody was raised using the C terminal Of C14Orf130 corresponding to a region with amino acids DRSDPLMDTLSSMNRVQQVELICEYNDLKTELKDYLKRFADEGTVVKRED
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Western Blot (WB)
(C14ORF130 antibody (MBS5301656) used at 1.25 ug/ml to detect target protein.)
Western Blot (WB)
(C14ORF130 antibody (MBS5301656) used at 1.25 ug/ml to detect target protein.)
Related Product Information for anti-C14ORF130 antibody
Rabbit polyclonal C14ORF130 antibody raised against the C terminal Of C14Orf130
Product Categories/Family for anti-C14ORF130 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
30 kDa (MW of target protein)
NCBI Official Full Name
chromosome 14 open reading frame 130, isoform CRA_b
NCBI Official Synonym Full Names
ubiquitin protein ligase E3 component n-recognin 7 (putative)
NCBI Official Symbol
UBR7
NCBI Official Synonym Symbols
C14orf130
NCBI Protein Information
putative E3 ubiquitin-protein ligase UBR7
UniProt Protein Name
Putative E3 ubiquitin-protein ligase UBR7
UniProt Gene Name
UBR7
UniProt Synonym Gene Names
C14orf130
UniProt Entry Name
UBR7_HUMAN
Uniprot Description
UBR7: E3 ubiquitin-protein ligase which is a component of the N-end rule pathway. Recognizes and binds to proteins bearing specific N-terminal residues that are destabilizing according to the N-end rule, leading to their ubiquitination and subsequent degradation.
Protein type: Ligase; Ubiquitin ligase; Ubiquitin conjugating system; EC 6.3.2.-; EC 6.3.2.19
Chromosomal Location of Human Ortholog: 14q32.12
Molecular Function: zinc ion binding; ligase activity
Biological Process: protein ubiquitination
Research Articles on C14ORF130
Similar Products
Product Notes
The C14ORF130 ubr7 (Catalog #AAA5301656) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The C14ORF130 antibody reacts with Human, Mouse, Rat, Dog and may cross-react with other species as described in the data sheet. AAA Biotech's C14ORF130 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC). WB: 1.25 ug/ml IHC: 4-8 ug/ml. Researchers should empirically determine the suitability of the C14ORF130 ubr7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "C14ORF130, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
