Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (MIF4GD antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X)

Rabbit MIF4GD Polyclonal Antibody | anti-MIF4GD antibody

MIF4GD antibody

Gene Names
MIF4GD; MIFD; AD023; SLIP1
Reactivity
Human, Mouse, Rat, Dog
Applications
Western Blot, Immunohistochemistry
Purity
Total IgG Protein A purified
Synonyms
MIF4GD; Polyclonal Antibody; MIF4GD antibody; Polyclonal MIF4GD; Anti-MIF4GD; MIFGD 4; MIFGD-4; Mif4G Domain Containing; anti-MIF4GD antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat, Dog
Clonality
Polyclonal
Specificity
MIF4GD antibody was raised against the C terminal of MIF4GD
Purity/Purification
Total IgG Protein A purified
Form/Format
Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of MIF4GD antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
256
Applicable Applications for anti-MIF4GD antibody
Western Blot (WB), Immunohistochemistry (IHC)
Application Notes
WB: 1.25 ug/ml
IHC: 4-8 ug/ml
Biological Significance
MIF4GD is a protein which contains an MIF4G domain.
Cross-Reactivity
Human,Mouse,Rat,Dog
Immunogen
MIF4GD antibody was raised using the C terminal of MIF4GD corresponding to a region with amino acids LFVLIRDGFLLPTGLSSLAQLLLLEIIEFRAAGWKTTPAAHKYYYSEVSD
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Immunohistochemistry (IHC)

(MIF4GD antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X)

Immunohistochemistry (IHC) (MIF4GD antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X)

Western Blot (WB)

(MIF4GD antibody (MBS5300385) used at 1.25 ug/ml to detect target protein.)

Western Blot (WB) (MIF4GD antibody (MBS5300385) used at 1.25 ug/ml to detect target protein.)
Related Product Information for anti-MIF4GD antibody
Rabbit polyclonal MIF4GD antibody raised against the C terminal of MIF4GD
Product Categories/Family for anti-MIF4GD antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
28 kDa (MW of target protein)
NCBI Official Full Name
MIF4G domain-containing protein isoform 2
NCBI Official Synonym Full Names
MIF4G domain containing
NCBI Official Symbol
MIF4GD
NCBI Official Synonym Symbols
MIFD; AD023; SLIP1
NCBI Protein Information
MIF4G domain-containing protein
UniProt Protein Name
MIF4G domain-containing protein
UniProt Gene Name
MIF4GD
UniProt Synonym Gene Names
SLIP1; hSLIP1
UniProt Entry Name
MI4GD_HUMAN

NCBI Description

This gene encodes a protein which interacts with the N-terminus of the stem-loop binding protein (SLBP) and the 3' end of histone mRNA. This interaction facilitates the activation of histone mRNA translation. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jun 2011]

Uniprot Description

MIF4GD: Functions in replication-dependent translation of histone mRNAs which differ from other eukaryotic mRNAs in that they do not end with a poly-A tail but a stem-loop. May participate in circularizing those mRNAs specifically enhancing their translation. Belongs to the MIF4GD family. 2 isoforms of the human protein are produced by alternative splicing.

Chromosomal Location of Human Ortholog: 17q25.1

Cellular Component: cytoplasm; nucleolus

Molecular Function: protein C-terminus binding; protein binding; RNA binding

Biological Process: regulation of translation

Research Articles on MIF4GD

Similar Products

Product Notes

The MIF4GD mif4gd (Catalog #AAA5300385) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MIF4GD antibody reacts with Human, Mouse, Rat, Dog and may cross-react with other species as described in the data sheet. AAA Biotech's MIF4GD can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC). WB: 1.25 ug/ml IHC: 4-8 ug/ml. Researchers should empirically determine the suitability of the MIF4GD mif4gd for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MIF4GD, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.