Immunohistochemistry (IHC)
(Kidney)
Rabbit EIF3E Polyclonal Antibody | anti-EIF3E antibody
EIF3E antibody - N-terminal region
Gene Names
EIF3E; INT6; EIF3S6; EIF3-P48; eIF3-p46
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
EIF3E; Polyclonal Antibody; EIF3E antibody - N-terminal region; anti-EIF3E antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ELLQGKLDLLSDTNMVDFAMDVYKNLYSDDIPHALREKRTTVVAQLKQLQ
Sequence Length
445
Applicable Applications for anti-EIF3E antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 75%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human EIF3E
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Immunohistochemistry (IHC)
(Kidney)
Immunohistochemistry (IHC)
(Kidney)
Western Blot (WB)
(EIF3E antibody - N-terminal region validated by WB using B8 mouse cells and HEK293 human cells at 1: 1,000.)
Western Blot (WB)
(EIF3E antibody - N-terminal region validated by WB using B8 mouse cells and HEK293 human cells at 1: 1,000.)
Western Blot (WB)
(WB Suggested Anti-EIF3E Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 293T cell lysateEIF3E is supported by BioGPS gene expression data to be expressed in HEK293T)
Western Blot (WB)
(WB Suggested Anti-EIF3E Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 293T cell lysateEIF3E is supported by BioGPS gene expression data to be expressed in HEK293T)
Related Product Information for anti-EIF3E antibody
This is a rabbit polyclonal antibody against EIF3E. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: EIF3E belongs to the eIF-3 subunit E family.It is a component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis. EIF3E is required for nonsense-mediated mRNA decay (NMD); It may act in conjunction with UPF2 to divert mRNAs from translation to the NMD pathway. The protein may interact with MCM7 and EPAS1 and regulate the proteasome-mediated degradation of these proteins.
Target Description: EIF3E belongs to the eIF-3 subunit E family.It is a component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis. EIF3E is required for nonsense-mediated mRNA decay (NMD); It may act in conjunction with UPF2 to divert mRNAs from translation to the NMD pathway. The protein may interact with MCM7 and EPAS1 and regulate the proteasome-mediated degradation of these proteins.
Product Categories/Family for anti-EIF3E antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
52kDa
NCBI Official Full Name
eukaryotic translation initiation factor 3 subunit E
NCBI Official Synonym Full Names
eukaryotic translation initiation factor 3 subunit E
NCBI Official Symbol
EIF3E
NCBI Official Synonym Symbols
INT6; EIF3S6; EIF3-P48; eIF3-p46
NCBI Protein Information
eukaryotic translation initiation factor 3 subunit E
UniProt Protein Name
Eukaryotic translation initiation factor 3 subunit E
UniProt Gene Name
EIF3E
UniProt Entry Name
EIF3E_HUMAN
Research Articles on EIF3E
Similar Products
Product Notes
The EIF3E eif3e (Catalog #AAA3208896) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The EIF3E antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's EIF3E can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the EIF3E eif3e for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ELLQGKLDLL SDTNMVDFAM DVYKNLYSDD IPHALREKRT TVVAQLKQLQ. It is sometimes possible for the material contained within the vial of "EIF3E, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
