Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: ATP1A2Sample Tissue: Human Mesenchymoma Tumor lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human ATP1A2 Polyclonal Antibody | anti-ATP1A2 antibody

ATP1A2 Antibody - N-terminal region

Gene Names
ATP1A2; FHM2; MHP2
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
ATP1A2; Polyclonal Antibody; ATP1A2 Antibody - N-terminal region; anti-ATP1A2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: REYSPAATTAENGGGKKKQKEKELDELKKEVAMDDHKLSLDELGRKYQVD
Sequence Length
1020
Applicable Applications for anti-ATP1A2 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human ATP1A2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: ATP1A2Sample Tissue: Human Mesenchymoma Tumor lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ATP1A2Sample Tissue: Human Mesenchymoma Tumor lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-ATP1A2 antibody
The protein encoded by this gene belongs to the family of P-type cation transport ATPases, and to the subfamily of Na+/K+ -ATPases. Na+/K+ -ATPase is an integral membrane protein responsible for establishing and maintaining the electrochemical gradients of Na and K ions across the plasma membrane. These gradients are essential for osmoregulation, for sodium-coupled transport of a variety of organic and inorganic molecules, and for electrical excitability of nerve and muscle. This enzyme is composed of two subunits, a large catalytic subunit (alpha) and a smaller glycoprotein subunit (beta). The catalytic subunit of Na+/K+ -ATPase is encoded by multiple genes. This gene encodes an alpha 2 subunit. Mutations in this gene result in familial basilar or hemiplegic migraines, and in a rare syndrome known as alternating hemiplegia of childhood.
Product Categories/Family for anti-ATP1A2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
477
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
112 kDa
NCBI Official Full Name
sodium/potassium-transporting ATPase subunit alpha-2
NCBI Official Synonym Full Names
ATPase Na+/K+ transporting subunit alpha 2
NCBI Official Symbol
ATP1A2
NCBI Official Synonym Symbols
FHM2; MHP2
NCBI Protein Information
sodium/potassium-transporting ATPase subunit alpha-2
UniProt Protein Name
Sodium/potassium-transporting ATPase subunit alpha-2
UniProt Gene Name
ATP1A2
UniProt Synonym Gene Names
KIAA0778; Na(+)/K(+) ATPase alpha-2 subunit
UniProt Entry Name
AT1A2_HUMAN

NCBI Description

The protein encoded by this gene belongs to the family of P-type cation transport ATPases, and to the subfamily of Na+/K+ -ATPases. Na+/K+ -ATPase is an integral membrane protein responsible for establishing and maintaining the electrochemical gradients of Na and K ions across the plasma membrane. These gradients are essential for osmoregulation, for sodium-coupled transport of a variety of organic and inorganic molecules, and for electrical excitability of nerve and muscle. This enzyme is composed of two subunits, a large catalytic subunit (alpha) and a smaller glycoprotein subunit (beta). The catalytic subunit of Na+/K+ -ATPase is encoded by multiple genes. This gene encodes an alpha 2 subunit. Mutations in this gene result in familial basilar or hemiplegic migraines, and in a rare syndrome known as alternating hemiplegia of childhood. [provided by RefSeq, Oct 2008]

Uniprot Description

ATP1A2: This is the catalytic component of the active enzyme, which catalyzes the hydrolysis of ATP coupled with the exchange of sodium and potassium ions across the plasma membrane. This action creates the electrochemical gradient of sodium and potassium, providing the energy for active transport of various nutrients. Defects in ATP1A2 are the cause of familial hemiplegic migraine type 2 (FHM2). FHM2 is a rare, severe, autosomal dominant subtype of migraine characterized by aura and some hemiparesis. Defects in ATP1A2 are a cause of alternating hemiplegia of childhood 1 (AHC1). AHC is typically distinguished from familial hemiplegic migraine by infantile onset of the symptoms and high prevalence of associated neurological deficits that become increasingly obvious with age. Belongs to the cation transport ATPase (P-type) (TC 3.A.3) family. Type IIC subfamily.

Protein type: Hydrolase; Membrane protein, multi-pass; Transporter, ion channel; Membrane protein, integral; Transporter; EC 3.6.3.9

Chromosomal Location of Human Ortholog: 1q23.2

Cellular Component: T-tubule; cytoplasm; dendritic spine; plasma membrane; synapse; caveola; sodium:potassium-exchanging ATPase complex; endosome; vesicle

Molecular Function: metal ion binding; chaperone binding; sodium:potassium-exchanging ATPase activity; ATP binding

Biological Process: regulation of smooth muscle contraction; response to nicotine; cellular sodium ion homeostasis; negative regulation of heart contraction; metabolic process; adult locomotory behavior; regulation of striated muscle contraction; sodium ion transport; neurological control of breathing; cellular potassium ion homeostasis; negative regulation of striated muscle contraction; potassium ion import; regulation of vasoconstriction; reduction of cytosolic calcium ion concentration; regulation of blood pressure; ATP hydrolysis coupled proton transport; neurotransmitter uptake; visual learning; locomotion; transmembrane transport; regulation of the force of heart contraction; potassium ion transport; cardiac muscle contraction

Disease: Migraine, Familial Hemiplegic, 2; Alternating Hemiplegia Of Childhood 1

Research Articles on ATP1A2

Similar Products

Product Notes

The ATP1A2 atp1a2 (Catalog #AAA3221443) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ATP1A2 Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ATP1A2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ATP1A2 atp1a2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: REYSPAATTA ENGGGKKKQK EKELDELKKE VAMDDHKLSL DELGRKYQVD. It is sometimes possible for the material contained within the vial of "ATP1A2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.