Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-EI24 AntibodyTitration: 1.0 ug/mlPositive Control: Hela Whole Cell)

Rabbit EI24 Polyclonal Antibody | anti-EI24 antibody

EI24 antibody - N-terminal region

Gene Names
EI24; EPG4; PIG8; TP53I8
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
EI24; Polyclonal Antibody; EI24 antibody - N-terminal region; anti-EI24 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ICTISKLDARIQQKREEQRRRRASSVLAQRRAQSIERKQESEPRIVSRIF
Sequence Length
262
Applicable Applications for anti-EI24 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 77%; Zebrafish: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-EI24 AntibodyTitration: 1.0 ug/mlPositive Control: Hela Whole Cell)

Western Blot (WB) (WB Suggested Anti-EI24 AntibodyTitration: 1.0 ug/mlPositive Control: Hela Whole Cell)
Related Product Information for anti-EI24 antibody
This is a rabbit polyclonal antibody against EI24. It was validated on Western Blot

Target Description: This gene has higher expression in p53-expressing cells than in control cells and is an immediate-early induction target of p53-mediated apoptosis. The protein encoded by this gene contains six putative transmembrane domains and may suppress cell growth by inducing apoptotic cell death through the caspase 9 and mitochondrial pathways. This gene is located on human chromosome 11q24, a region frequently altered in cancers. Alternative splicing results in two transcript variants encoding different isoforms.
Product Categories/Family for anti-EI24 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
30kDa
NCBI Official Synonym Full Names
EI24 autophagy associated transmembrane protein
NCBI Official Symbol
EI24
NCBI Official Synonym Symbols
EPG4; PIG8; TP53I8
NCBI Protein Information
etoposide-induced protein 2.4 homolog
UniProt Protein Name
Etoposide-induced protein 2.4 homolog
Protein Family
UniProt Gene Name
EI24
UniProt Synonym Gene Names
PIG8
UniProt Entry Name
EI24_HUMAN

NCBI Description

This gene encodes a putative tumor suppressor and has higher expression in p53-expressing cells than in control cells and is an immediate-early induction target of p53-mediated apoptosis. The encoded protein may suppress cell growth by inducing apoptotic cell death through the caspase 9 and mitochondrial pathways. This gene is located on human chromosome 11q24, a region frequently altered in cancers. Alternative splicing results in multiple transcript variants. Pseudogenes of this gene have been defined on chromosomes 1, 3, 7, and 8. [provided by RefSeq, Feb 2014]

Uniprot Description

EI24: a p53-induced gene that appears to play a role in p53-mediated events. May activate apoptosis and reduce tumor invasiveness. Mutations in its gene have been associated with breast cancer.

Protein type: Apoptosis; Membrane protein, integral; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 11q24

Cellular Component: Golgi apparatus; endoplasmic reticulum membrane; nuclear membrane; membrane; endoplasmic reticulum; cytoplasm; integral to membrane

Biological Process: response to drug; DNA damage response, signal transduction resulting in induction of apoptosis; apoptosis; autophagy; negative regulation of cell growth; neuromuscular process controlling balance

Research Articles on EI24

Similar Products

Product Notes

The EI24 ei24 (Catalog #AAA3216604) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The EI24 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's EI24 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the EI24 ei24 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ICTISKLDAR IQQKREEQRR RRASSVLAQR RAQSIERKQE SEPRIVSRIF. It is sometimes possible for the material contained within the vial of "EI24, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.