Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: Ehd1Sample Tissue: Rat Lung lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Rat EHD1 Polyclonal Antibody | anti-EHD1 antibody

EHD1 Antibody - middle region

Gene Names
EHD1; PAST; PAST1; H-PAST; HPAST1
Reactivity
Rat
Applications
Western Blot
Purity
Affinity purified
Synonyms
EHD1; Polyclonal Antibody; EHD1 Antibody - middle region; anti-EHD1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Rat
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 27% sucrose.
Sequence
Synthetic peptide located within the following region: ARLAKVHAYIISSLKKEMPNVFGKESKKKELVNNLGEIYQKIEREHQISS
Sequence Length
534
Applicable Applications for anti-EHD1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human EHD1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: Ehd1Sample Tissue: Rat Lung lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: Ehd1Sample Tissue: Rat Lung lysatesAntibody Dilution: 1.0ug/ml)
Product Categories/Family for anti-EHD1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
60 kDa
NCBI Official Full Name
EH domain-containing protein 1 isoform 1
NCBI Official Synonym Full Names
EH domain containing 1
NCBI Official Symbol
EHD1
NCBI Official Synonym Symbols
PAST; PAST1; H-PAST; HPAST1
NCBI Protein Information
EH domain-containing protein 1
UniProt Protein Name
EH domain-containing protein 1
UniProt Gene Name
Ehd1
UniProt Entry Name
EHD1_RAT

NCBI Description

This gene belongs to a highly conserved gene family encoding EPS15 homology (EH) domain-containing proteins. The protein-binding EH domain was first noted in EPS15, a substrate for the epidermal growth factor receptor. The EH domain has been shown to be an important motif in proteins involved in protein-protein interactions and in intracellular sorting. The protein encoded by this gene is thought to play a role in the endocytosis of IGF1 receptors. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Sep 2013]

Research Articles on EHD1

Similar Products

Product Notes

The EHD1 ehd1 (Catalog #AAA3220555) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The EHD1 Antibody - middle region reacts with Rat and may cross-react with other species as described in the data sheet. AAA Biotech's EHD1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the EHD1 ehd1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ARLAKVHAYI ISSLKKEMPN VFGKESKKKE LVNNLGEIYQ KIEREHQISS. It is sometimes possible for the material contained within the vial of "EHD1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.