Western Blot (WB)
(Host: RabbitTarget Name: EHD3Sample Tissue: Human Jurkat Whole Cell lysatesAntibody Dilution: 1ug/ml)
Rabbit anti-Human EHD3 Polyclonal Antibody | anti-EHD3 antibody
EHD3 Antibody - N-terminal region
Gene Names
EHD3; PAST3
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
EHD3; Polyclonal Antibody; EHD3 Antibody - N-terminal region; anti-EHD3 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FSWLGTDDRRRKDPEVFQTVSEGLKKLYKSKLLPLEEHYRFHEFHSPALE
Sequence Length
535
Applicable Applications for anti-EHD3 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human EHD3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: EHD3Sample Tissue: Human Jurkat Whole Cell lysatesAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: EHD3Sample Tissue: Human Jurkat Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-EHD3 antibody
ATP- and membrane-binding protein that controls membrane reorganization/tubulation upon ATP hydrolysis. In vitro causes tubulation of endocytic membranes. Binding to phosphatidic acid induces its membrane tubulation activity. Plays a role in endocytic transport. Involved in early endosome to recycling endosome compartment (ERC), retrograde early endosome to Golgi, and endosome to plasma membrane (rapid recycling) protein transport. Involved in the regulation of Golgi maintenance and morphology. Involved in the recycling of internalized D1 dopamine receptor. Plays a role in cardiac protein trafficking probably implicating ANK. Involved in the ventricular membrane targeting of SLC8A1 and CACNA1C and probably the atrial membrane localization of CACNA1GG and CACNA1H implicated in the regulation of atrial myocyte excitability and cardiac conduction. In conjunction with EHD4 may be involved in endocytic trafficking of KDR/VEGFR2 implicated in control of glomerular function. Involved in the rapid recycling of integrin beta-3 implicated in cell adhesion maintenance. Involved in the unidirectional retrograde dendritic transport of endocytosed BACE1 and in efficient sorting of BACE1 to axons implicating a function in neuronal APP processing. Plays a role in the formation of the ciliary vesicle, an early step in cilium biogenesis; possibly sharing redundant functions with EHD1.
Product Categories/Family for anti-EHD3 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
58 kDa
NCBI Official Full Name
EH domain-containing protein 3
NCBI Official Synonym Full Names
EH domain containing 3
NCBI Official Symbol
EHD3
NCBI Official Synonym Symbols
PAST3
NCBI Protein Information
EH domain-containing protein 3
UniProt Protein Name
EH domain-containing protein 2
Protein Family
UniProt Gene Name
EHD2
UniProt Entry Name
EHD2_HUMAN
Uniprot Description
EHD2: Plays a role in membrane reorganization in response to nucleotide hydrolysis. Binds to liposomes and deforms them into tubules. Plays a role in membrane trafficking between the plasma membrane and endosomes. Important for the internalization of GLUT4. Required for normal fusion of myoblasts to skeletal muscle myotubes. Binds ATP; does not bind GTP.
Protein type: Vesicle
Chromosomal Location of Human Ortholog: 19q13.3
Cellular Component: caveola; cytosol; endosome membrane; extrinsic to membrane; nucleus; perinuclear region of cytoplasm; plasma membrane; recycling endosome membrane
Molecular Function: ATP binding; calcium ion binding; GTP binding; hydrolase activity; nucleic acid binding; protein binding; protein domain specific binding
Biological Process: blood coagulation; cortical actin cytoskeleton organization and biogenesis; endocytic recycling; endocytosis; metabolic process
Research Articles on EHD3
Similar Products
Product Notes
The EHD3 ehd2 (Catalog #AAA3221828) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The EHD3 Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's EHD3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the EHD3 ehd2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FSWLGTDDRR RKDPEVFQTV SEGLKKLYKS KLLPLEEHYR FHEFHSPALE. It is sometimes possible for the material contained within the vial of "EHD3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
