Western Blot (WB)
(Host: RabbitTarget Name: EFR3ASample Tissue: Human COLO205 Whole CellAntibody Dilution: 1ug/ml)
Rabbit EFR3A Polyclonal Antibody | anti-EFR3A antibody
EFR3A Antibody - C-terminal region
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
EFR3A; Polyclonal Antibody; EFR3A Antibody - C-terminal region; anti-EFR3A antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DTSGMEEQEKEKRRLVIEKFQKAPFEEIAAQCESKANLLHDRLAQILELT
Sequence Length
777
Applicable Applications for anti-EFR3A antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human EFR3A
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: EFR3ASample Tissue: Human COLO205 Whole CellAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: EFR3ASample Tissue: Human COLO205 Whole CellAntibody Dilution: 1ug/ml)
Related Product Information for anti-EFR3A antibody
This is a rabbit polyclonal antibody against EFR3A. It was validated on Western Blot
Target Description: This gene encodes a membrane protein. Studies with orthologous gene in mouse show that it is differentially expressed in the auditory brainstem neurons of mice with hearing deficit, compared to mice with normal hearing ability, suggesting a role for this gene in hearing.
Target Description: This gene encodes a membrane protein. Studies with orthologous gene in mouse show that it is differentially expressed in the auditory brainstem neurons of mice with hearing deficit, compared to mice with normal hearing ability, suggesting a role for this gene in hearing.
Product Categories/Family for anti-EFR3A antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
85kDa
NCBI Official Full Name
protein EFR3 homolog A isoform 1
NCBI Official Synonym Full Names
EFR3 homolog A
NCBI Official Symbol
EFR3A
NCBI Protein Information
protein EFR3 homolog A
UniProt Protein Name
Protein EFR3 homolog A
Protein Family
UniProt Gene Name
EFR3A
UniProt Synonym Gene Names
KIAA0143
UniProt Entry Name
EFR3A_HUMAN
NCBI Description
The protein encoded by this gene is part of a complex that plays a role in maintaining an active pool of phosphatidylinositol 4-kinase (PI4K) at the plasma membrane. This protein is thought to be a peripheral membrane protein that associates with the plasma membrane through palmitoylation. Studies indicate that this gene product plays a role in controlling G protein-coupled receptor (GPCR) activity by affecting receptor phosphorylation. Whole exome sequencing studies have implicated mutations in this gene with autism spectrum disorders. [provided by RefSeq, Apr 2016]
Research Articles on EFR3A
Similar Products
Product Notes
The EFR3A efr3a (Catalog #AAA3218406) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The EFR3A Antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's EFR3A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the EFR3A efr3a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DTSGMEEQEK EKRRLVIEKF QKAPFEEIAA QCESKANLLH DRLAQILELT. It is sometimes possible for the material contained within the vial of "EFR3A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
