Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: SYUBSample Type: 786-0 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit SNCB Polyclonal Antibody | anti-SNCB antibody

SNCB Antibody - C-terminal region

Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SNCB; Polyclonal Antibody; SNCB Antibody - C-terminal region; anti-SNCB antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GLVKREEFPTDLKPEEVAQEAAEEPLIEPLMEPEGESYEDPPQEEYQEYE
Sequence Length
134
Applicable Applications for anti-SNCB antibody
Western Blot (WB)
Homology
Cow: 86%; Dog: 93%; Guinea Pig: 86%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 86%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human SNCB
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: SYUBSample Type: 786-0 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: SYUBSample Type: 786-0 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-SNCB antibody
This is a rabbit polyclonal antibody against SYUB. It was validated on Western Blot

Target Description: The protein encoded by this gene is highly homologous to alpha-synuclein. These proteins are abundantly expressed in the brain and putatively inhibit phospholipase D2 selectively. The encoded protein, which may play a role in neuronal plasticity, is abundant in neurofibrillary lesions of patients with Alzheimer disease. This protein has been shown to be highly expressed in the substantia nigra of the brain, a region of neuronal degeneration in patients with Parkinson disease; however, no direct relation to Parkinson disease has been established. Two transcript variants encoding the same protein have been found for this gene.
Product Categories/Family for anti-SNCB antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
14kDa
NCBI Official Full Name
beta-synuclein isoform X2
NCBI Official Synonym Full Names
synuclein beta
NCBI Official Symbol
SNCB
NCBI Protein Information
beta-synuclein
UniProt Protein Name
Beta-synuclein
Protein Family
UniProt Gene Name
SNCB
UniProt Entry Name
SYUB_HUMAN

NCBI Description

This gene encodes a member of a small family of proteins that inhibit phospholipase D2 and may function in neuronal plasticity. The encoded protein is abundant in lesions of patients with Alzheimer disease. A mutation in this gene was found in individuals with dementia with Lewy bodies. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2015]

Uniprot Description

SNCB: a member of the synuclein family. Abundantly expressed in the brain. Inhibits phospholipase D2 selectively. May play a role in neuronal plasticity, is abundant in neurofibrillary lesions of Alzheimer's patients. Highly expressed in the substantia nigra of the brain, a region of neuronal degeneration in patients with Parkinson disease.

Protein type: Adaptor/scaffold

Chromosomal Location of Human Ortholog: 5q35

Cellular Component: nucleoplasm; Golgi apparatus; growth cone; mitochondrion; cell soma; cytoplasm; terminal button; inclusion body

Molecular Function: phospholipase inhibitor activity; beta-tubulin binding; calcium ion binding; alpha-tubulin binding

Biological Process: synaptic transmission; negative regulation of catalytic activity; synapse organization and biogenesis; negative regulation of neuron apoptosis; dopamine metabolic process

Disease: Dementia, Lewy Body

Research Articles on SNCB

Similar Products

Product Notes

The SNCB sncb (Catalog #AAA3201773) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SNCB Antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SNCB can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SNCB sncb for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GLVKREEFPT DLKPEEVAQE AAEEPLIEPL MEPEGESYED PPQEEYQEYE. It is sometimes possible for the material contained within the vial of "SNCB, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.