Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: HIP1Sample Type: A549 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit HIP1 Polyclonal Antibody | anti-HIP1 antibody

HIP1 Antibody - C-terminal region

Gene Names
HIP1; SHON; HIP-I; ILWEQ; SHONbeta; SHONgamma
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
HIP1; Polyclonal Antibody; HIP1 Antibody - C-terminal region; anti-HIP1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: IVESGRGTASPKEFYAKNSRWTEGLISASKAVGWGATVMVDAADLVVQGR
Sequence Length
1037
Applicable Applications for anti-HIP1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human HIP1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: HIP1Sample Type: A549 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: HIP1Sample Type: A549 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-HIP1 antibody
This is a rabbit polyclonal antibody against HIP1. It was validated on Western Blot

Target Description: The product of this gene is a membrane-associated protein that functions in clathrin-mediated endocytosis and protein trafficking within the cell. The encoded protein binds to the huntingtin protein in the brain; this interaction is lost in Huntington's disease. Alternative splicing results in multiple transcript variants.
Product Categories/Family for anti-HIP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
114kDa
NCBI Official Full Name
Huntingtin-interacting protein 1
NCBI Official Synonym Full Names
huntingtin interacting protein 1
NCBI Official Symbol
HIP1
NCBI Official Synonym Symbols
SHON; HIP-I; ILWEQ; SHONbeta; SHONgamma
NCBI Protein Information
huntingtin-interacting protein 1
UniProt Protein Name
Huntingtin-interacting protein 1
Protein Family
UniProt Gene Name
HIP1
UniProt Synonym Gene Names
HIP-1; HIP-I
UniProt Entry Name
HIP1_HUMAN

NCBI Description

The product of this gene is a membrane-associated protein that functions in clathrin-mediated endocytosis and protein trafficking within the cell. The encoded protein binds to the huntingtin protein in the brain; this interaction is lost in Huntington's disease. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013]

Uniprot Description

HIP1: Plays a role in clathrin-mediated endocytosis and trafficking. Involved in regulating AMPA receptor trafficking in the central nervous system in an NMDA-dependent manner. Enhances androgen receptor (AR)-mediated transcription. May act as a proapoptotic protein that induces cell death by acting through the intrinsic apoptosis pathway. Binds 3-phosphoinositides (via ENTH domain). May act through the ENTH domain to promote cell survival by stabilizing receptor tyrosine kinases following ligand-induced endocytosis. May play a functional role in the cell filament networks. May be required for differentiation, proliferation, and/or survival of somatic and germline progenitors. A chromosomal aberration involving HIP1 is found in a form of chronic myelomonocytic leukemia (CMML). Translocation t(5;7)(q33;q11.2) with PDGFRB. The chimeric HIP1-PDGFRB transcript results from an in-frame fusion of the two genes. The reciprocal PDGFRB-HIP1 transcript is not expressed. Belongs to the SLA2 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Cytoskeletal; Apoptosis

Chromosomal Location of Human Ortholog: 7q11.23

Cellular Component: Golgi apparatus; cytoskeleton; intracellular membrane-bound organelle; clathrin-coated vesicle; membrane; cytoplasm; clathrin coated vesicle membrane; nucleus

Molecular Function: protein binding, bridging; clathrin binding; protein binding; structural constituent of cytoskeleton; actin binding; phosphoinositide binding

Biological Process: regulation of apoptosis; caspase activation; clathrin cage assembly; transcription, DNA-dependent; regulation of transcription, DNA-dependent; apoptosis; endocytosis; cell differentiation; actin cytoskeleton organization and biogenesis; positive regulation of receptor-mediated endocytosis

Disease: Prostate Cancer

Research Articles on HIP1

Similar Products

Product Notes

The HIP1 hip1 (Catalog #AAA3216098) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HIP1 Antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's HIP1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the HIP1 hip1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: IVESGRGTAS PKEFYAKNSR WTEGLISASK AVGWGATVMV DAADLVVQGR. It is sometimes possible for the material contained within the vial of "HIP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.