Western Blot (WB)
(Host: RabbitTarget Name: TMEFF2Sample Type: Colorectal Tumor lysatesAntibody Dilution: 1.0ug/ml)
Rabbit TMEFF2 Polyclonal Antibody | anti-TMEFF2 antibody
TMEFF2 Antibody - C-terminal region
Gene Names
TMEFF2; TR; HPP1; TPEF; TR-2; TENB2; CT120.2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TMEFF2; Polyclonal Antibody; TMEFF2 Antibody - C-terminal region; anti-TMEFF2 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: NACQIKEASCQKQEKIEVMSLGRCQDNTTTTTKSEDGHYARTDYAENANK
Sequence Length
346
Applicable Applications for anti-TMEFF2 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human TMEFF2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: TMEFF2Sample Type: Colorectal Tumor lysatesAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: TMEFF2Sample Type: Colorectal Tumor lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-TMEFF2 antibody
This is a rabbit polyclonal antibody against TMEFF2. It was validated on Western Blot
Target Description: TMEFF2 may be a survival factor for hippocampal and mesencephalic neurons. The shedded form up-regulates cancer cell proliferation, probably by promoting ERK1/2 phosphorylation.
Target Description: TMEFF2 may be a survival factor for hippocampal and mesencephalic neurons. The shedded form up-regulates cancer cell proliferation, probably by promoting ERK1/2 phosphorylation.
Product Categories/Family for anti-TMEFF2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38kDa
NCBI Official Full Name
tomoregulin-2 isoform 3
NCBI Official Synonym Full Names
transmembrane protein with EGF like and two follistatin like domains 2
NCBI Official Symbol
TMEFF2
NCBI Official Synonym Symbols
TR; HPP1; TPEF; TR-2; TENB2; CT120.2
NCBI Protein Information
tomoregulin-2
UniProt Protein Name
Tomoregulin-2
Protein Family
UniProt Gene Name
TMEFF2
UniProt Synonym Gene Names
HPP1; TENB2; TPEF; TR-2
NCBI Description
This gene encodes a member of the tomoregulin family of transmembrane proteins. This protein has been shown to function as both an oncogene and a tumor suppressor depending on the cellular context and may regulate prostate cancer cell invasion. Multiple soluble forms of this protein have been identified that arise from both an alternative splice variant and ectodomain shedding. Additionally, this gene has been found to be hypermethylated in multiple cancer types. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2015]
Uniprot Description
May be a survival factor for hippocampal and mesencephalic neurons. The shedded form up-regulates cancer cell proliferation, probably by promoting ERK1/2 phosphorylation.
Research Articles on TMEFF2
Similar Products
Product Notes
The TMEFF2 tmeff2 (Catalog #AAA3208482) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TMEFF2 Antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TMEFF2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TMEFF2 tmeff2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NACQIKEASC QKQEKIEVMS LGRCQDNTTT TTKSEDGHYA RTDYAENANK. It is sometimes possible for the material contained within the vial of "TMEFF2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
