Mouse anti-Human, Mouse EEF1E1 Polyclonal Antibody | anti-EEF1E1 antibody

EEF1E1 (Eukaryotic Translation Elongation Factor 1 epsilon-1, Aminoacyl tRNA Synthetase Complex-interacting Multifunctional Protein 3, Elongation Factor p18, Multisynthase Complex Auxiliary Component p18, AIMP3, P18)

Cat. Num. AAA6006038

• Gene Names: EEF1E1; P18; AIMP3
• Reactivity: Human, Mouse
• Applications: Western Blot, Immunofluorescence
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: EEF1E1; Polyclonal Antibody; EEF1E1 (Eukaryotic Translation Elongation Factor 1 epsilon-1; Aminoacyl tRNA Synthetase Complex-interacting Multifunctional Protein 3; Elongation Factor p18; Multisynthase Complex Auxiliary Component p18; AIMP3; P18); Anti -EEF1E1 (Eukaryotic Translation Elongation Factor 1 epsilon-1; anti-EEF1E1 antibody

• Host: Mouse
• Reactivity: Human, Mouse
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human EEF1E1.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MAAAAELSLLEKSLGLSKGNKYSAQGERQIPVLQTNNGPSLTGLTTIAAHLVKQANKEYLLGSTAEEKAIVQQWLEYRVTQVDGHSSKNDIHTLLKDLNSYLEDKVYLTGYNFTLADILLYYGLHRFIVDLTVQEKEKYLNVSRWFCHIQHYPGIRQHLSSVVFIKNRLYTNSH

• Applicable Applications for anti-EEF1E1 antibody: Western Blot (WB), Immunofluorescence (IF)
• Application Notes: Suitable for use in Immunofluorescence and Western Blot.; Dilution: Immunofluorescence: 10ug/ml
• Immunogen: Full length human EEF1E1, aa1-174 (NP_004271.1).
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(EEF1E1 polyclonal antibody. Western Blot analysis of EEF1E1 expression in HepG2.)

Western Blot (WB)

(Western Blot analysis of EEF1E1 expression in transfected 293T cell line by EEF1E1 polyclonal antibody. Lane 1: EEF1E1 transfected lysate (19.14kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of purified antibody to EEF1E1 on HeLa cell. [antibody concentration 10ug/ml])

Related Product Information for anti-EEF1E1 antibody

The normal progression of cells through the cell cycle is under the control of the cyclin dependent protein kinases Cdk4 and Cdk6, which are subject to inhibition by the mitotic inhibitory protein p16. Isolated members of the p16 family have been designated p15 and p18, respectively. The p16 related protein, p18, interacts strongly with Cdk6 and, to a lesser extent, with Cdk4, but lacks apparent interaction with other Cdks. Recombinant p18 has been shown to inhibit cyclin D-Cdk6 kinase activity. In contrast to p21/p27, which forms ternary complexes with cyclin-Cdks, and only binary complexes of p15, p16 and p18 have been identified in association with Cdk4 and/or Cdk6.

Product Categories/Family for anti-EEF1E1 antibody

Antibodies; Abs to Translation Initiation Factors

NCBI and Uniprot Product Information

• NCBI GI #: 208879470
• NCBI GeneID: 9521
• NCBI Accession #: NP_001129122.1
• NCBI GenBank Nucleotide #: NM_001135650.1
• UniProt Accession #: O43324; Q5THS2; C9JLK5
• Molecular Weight: 19,811 Da
• NCBI Official Full Name: eukaryotic translation elongation factor 1 epsilon-1 isoform 2
• NCBI Official Synonym Full Names: eukaryotic translation elongation factor 1 epsilon 1
• NCBI Official Symbol: EEF1E1
• NCBI Official Synonym Symbols: P18; AIMP3
• NCBI Protein Information: eukaryotic translation elongation factor 1 epsilon-1; ARS-interacting multifunctional protein 3; multisynthase complex auxiliary component p18; p18 component of aminoacyl-tRNA synthetase complex; aminoacyl tRNA synthetase complex-interacting multifunctional protein 3
• UniProt Protein Name: Eukaryotic translation elongation factor 1 epsilon-1
• Protein Family: Eukaryotic translation elongation factor
• UniProt Gene Name: EEF1E1
• UniProt Synonym Gene Names: AIMP3; P18
• UniProt Entry Name: MCA3_HUMAN

NCBI Description

This gene encodes a multifunctional protein that localizes to both the cytoplasm and nucleus. In the cytoplasm, the encoded protein is an auxiliary component of the macromolecular aminoacyl-tRNA synthase complex. However, its mouse homolog has been shown to translocate to the nucleus in response to DNA damage, and it plays a positive role in ATM/ATR-mediated p53 activation. Alternative splicing results in multiple transcript variants. Read-through transcription also exists between this gene and the neighboring downstream MUTED (muted homolog) gene. An EEF1E1-related pseudogene has been identified on chromosome 2. [provided by RefSeq, Dec 2010]

Uniprot Description

EEF1E1: Positive modulator of ATM response to DNA damage.

Protein type: Translation; Translation elongation

Chromosomal Location of Human Ortholog: 6p24.3

Cellular Component: cytoplasm; cytosol; nucleus

Molecular Function: protein binding

Biological Process: negative regulation of cell proliferation; tRNA aminoacylation for protein translation; positive regulation of apoptosis; gene expression; positive regulation of DNA damage response, signal transduction by p53 class mediator