Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-ARID3A Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysateARID3A is supported by BioGPS gene expression data to be expressed in HepG2)

Rabbit ARID3A Polyclonal Antibody | anti-ARID3A antibody

ARID3A antibody - middle region

Gene Names
ARID3A; DRIL1; DRIL3; BRIGHT; E2FBP1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ARID3A; Polyclonal Antibody; ARID3A antibody - middle region; anti-ARID3A antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QAAIDSNRREGRRQSFGGSLFAYSPGGAHGMLSSPKLPVSSLGLAASTNG
Sequence Length
593
Applicable Applications for anti-ARID3A antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 92%; Horse: 92%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Zebrafish: 77%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ARID3A
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-ARID3A Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysateARID3A is supported by BioGPS gene expression data to be expressed in HepG2)

Western Blot (WB) (WB Suggested Anti-ARID3A Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysateARID3A is supported by BioGPS gene expression data to be expressed in HepG2)
Related Product Information for anti-ARID3A antibody
This is a rabbit polyclonal antibody against ARID3A. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: ARID3A is a member of the ARID (AT-rich interaction domain) family of proteins which bind DNA. Other ARID family members have roles in embryonic patterning, cell lineage gene regulation, cell cycle control, transcriptional regulation and possibly in chromatin structure modification.This gene is a member of the ARID (AT-rich interaction domain) family of proteins which bind DNA. It was found by its homology to the Drosophila dead ringer gene, which is important for normal embryogenesis. Other ARID family members have roles in embryonic patterning, cell lineage gene regulation, cell cycle control, transcriptional regulation and possibly in chromatin structure modification.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
63kDa
NCBI Official Full Name
AT-rich interactive domain-containing protein 3A
NCBI Official Synonym Full Names
AT-rich interaction domain 3A
NCBI Official Symbol
ARID3A
NCBI Official Synonym Symbols
DRIL1; DRIL3; BRIGHT; E2FBP1
NCBI Protein Information
AT-rich interactive domain-containing protein 3A
UniProt Protein Name
AT-rich interactive domain-containing protein 3A
UniProt Gene Name
ARID3A
UniProt Synonym Gene Names
DRIL1; DRIL3; DRX; E2FBP1; ARID domain-containing protein 3A; Bright
UniProt Entry Name
ARI3A_HUMAN

NCBI Description

This gene encodes a member of the ARID (AT-rich interaction domain) family of DNA binding proteins. It was found by homology to the Drosophila dead ringer gene, which is important for normal embryogenesis. Other ARID family members have roles in embryonic patterning, cell lineage gene regulation, cell cycle control, transcriptional regulation, and possibly in chromatin structure modification. [provided by RefSeq, Jul 2008]

Uniprot Description

Bright: a member of the ARID (AT-rich interaction domain) family of transcription factors. It was found by its homology to the Drosophila dead ringer protein, which is important for normal embryogenesis. Binds a VH promoter proximal site necessary for induced mu-heavy-chain transcription. Binds the minor groove of a restricted ATC sequence that is sufficient for nuclear matrix association. This sequence motif is present in matrix-associating regions (MARS) proximal to the promoter and flanking E mu. Activates E mu-driven transcription by binding these sites. Contributes to localized control of accessibility and therefore nonrandom gene use during V(D)J recombination.

Protein type: Transcription factor

Chromosomal Location of Human Ortholog: 19p13.3

Cellular Component: nucleoplasm; Golgi apparatus; cytoplasm; nucleolus; lipid raft

Molecular Function: protein binding; protein homodimerization activity; chromatin binding

Biological Process: transcription, DNA-dependent; positive regulation of transcription from RNA polymerase II promoter

Research Articles on ARID3A

Similar Products

Product Notes

The ARID3A arid3a (Catalog #AAA3201213) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ARID3A antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's ARID3A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ARID3A arid3a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QAAIDSNRRE GRRQSFGGSL FAYSPGGAHG MLSSPKLPVS SLGLAASTNG. It is sometimes possible for the material contained within the vial of "ARID3A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.