Immunohistochemistry (IHC)
(Rabbit Anti-EEA1 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult LiverObserved Staining: Cytoplasm in hepatocytes, moderate signal, moderate tissue distributionPrimary Antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 secProtocol located in Reviews and Data.)
Rabbit EEA1 Polyclonal Antibody | anti-EEA1 antibody
EEA1 antibody - middle region
Gene Names
EEA1; MST105; ZFYVE2; MSTP105
Reactivity
Cow, Dog, Horse, Human, Rabbit, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
EEA1; Polyclonal Antibody; EEA1 antibody - middle region; anti-EEA1 antibody
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QEKRNQQILKDQVKKEEEELKKEFIEKEAKLHSEIKEKEVGMKKHEENEA
Sequence Length
1411
Applicable Applications for anti-EEA1 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 79%; Dog: 79%; Horse: 79%; Human: 100%; Rabbit: 79%; Rat: 90%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human EEA1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Immunohistochemistry (IHC)
(Rabbit Anti-EEA1 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult LiverObserved Staining: Cytoplasm in hepatocytes, moderate signal, moderate tissue distributionPrimary Antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 secProtocol located in Reviews and Data.)
Immunohistochemistry (IHC)
(Rabbit Anti-EEA1 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult LiverObserved Staining: Cytoplasm in hepatocytes, moderate signal, moderate tissue distributionPrimary Antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 secProtocol located in Reviews and Data.)
Western Blot (WB)
(WB Suggested Anti-EEA1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: 721_B cell lysateEEA1 is supported by BioGPS gene expression data to be expressed in 721_B)
Western Blot (WB)
(WB Suggested Anti-EEA1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: 721_B cell lysateEEA1 is supported by BioGPS gene expression data to be expressed in 721_B)
Related Product Information for anti-EEA1 antibody
This is a rabbit polyclonal antibody against EEA1. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: EEA1 is involved in neuronal synaptic vesicle function and axonal transport and growth. EEA1 may undergo calcium-dependent conformational changes that are required for binding to SNAP-25.
Target Description: EEA1 is involved in neuronal synaptic vesicle function and axonal transport and growth. EEA1 may undergo calcium-dependent conformational changes that are required for binding to SNAP-25.
Product Categories/Family for anti-EEA1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
162kDa
NCBI Official Full Name
early endosome antigen 1
NCBI Official Synonym Full Names
early endosome antigen 1
NCBI Official Symbol
EEA1
NCBI Official Synonym Symbols
MST105; ZFYVE2; MSTP105
NCBI Protein Information
early endosome antigen 1
UniProt Protein Name
Early endosome antigen 1
Protein Family
UniProt Gene Name
EEA1
UniProt Synonym Gene Names
ZFYVE2
UniProt Entry Name
EEA1_HUMAN
Research Articles on EEA1
Similar Products
Product Notes
The EEA1 eea1 (Catalog #AAA3213752) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The EEA1 antibody - middle region reacts with Cow, Dog, Horse, Human, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's EEA1 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the EEA1 eea1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QEKRNQQILK DQVKKEEEEL KKEFIEKEAK LHSEIKEKEV GMKKHEENEA. It is sometimes possible for the material contained within the vial of "EEA1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
