Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Rabbit Anti-ZNF419 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult LiverObserved Staining: Nuclear in hepatocytes, strong signal, wide tissue distributionPrimary Antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 secProtocol located in Reviews and Data.)

Rabbit ZNF419 Polyclonal Antibody | anti-ZNF419 antibody

ZNF419 antibody - N-terminal region

Gene Names
ZNF419; ZAPHIR; ZNF419A
Reactivity
Cow, Horse, Human
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
ZNF419; Polyclonal Antibody; ZNF419 antibody - N-terminal region; anti-ZNF419 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Horse, Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AAAALRDPAQVPVAADLLTDHEEGYVTFEDVAVYFSQEEWRLLDDAQRLL
Sequence Length
510
Applicable Applications for anti-ZNF419 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 92%; Horse: 83%; Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF419
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Rabbit Anti-ZNF419 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult LiverObserved Staining: Nuclear in hepatocytes, strong signal, wide tissue distributionPrimary Antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 secProtocol located in Reviews and Data.)

Immunohistochemistry (IHC) (Rabbit Anti-ZNF419 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult LiverObserved Staining: Nuclear in hepatocytes, strong signal, wide tissue distributionPrimary Antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 secProtocol located in Reviews and Data.)

Western Blot (WB)

(WB Suggested Anti-ZNF419 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 293T cell lysateZNF419 is supported by BioGPS gene expression data to be expressed in HEK293T)

Western Blot (WB) (WB Suggested Anti-ZNF419 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 293T cell lysateZNF419 is supported by BioGPS gene expression data to be expressed in HEK293T)
Related Product Information for anti-ZNF419 antibody
This is a rabbit polyclonal antibody against ZNF419. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: ZNF419A contains 1 KRAB domain and 11 C2H2-type zinc fingers and belongs to the krueppel C2H2-type zinc-finger protein family. NF419A may be involved in transcriptional regulation.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
58kDa
NCBI Official Full Name
zinc finger protein 419 isoform 2
NCBI Official Synonym Full Names
zinc finger protein 419
NCBI Official Symbol
ZNF419
NCBI Official Synonym Symbols
ZAPHIR; ZNF419A
NCBI Protein Information
zinc finger protein 419
UniProt Protein Name
Zinc finger protein 419
Protein Family
UniProt Gene Name
ZNF419
UniProt Synonym Gene Names
ZNF419A
UniProt Entry Name
ZN419_HUMAN

Research Articles on ZNF419

Similar Products

Product Notes

The ZNF419 znf419 (Catalog #AAA3204733) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ZNF419 antibody - N-terminal region reacts with Cow, Horse, Human and may cross-react with other species as described in the data sheet. AAA Biotech's ZNF419 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the ZNF419 znf419 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AAAALRDPAQ VPVAADLLTD HEEGYVTFED VAVYFSQEEW RLLDDAQRLL. It is sometimes possible for the material contained within the vial of "ZNF419, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.