Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: EDEM2Sample Tissue: Human HCT116 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human EDEM2 Polyclonal Antibody | anti-EDEM2 antibody

EDEM2 Antibody - N-terminal region

Gene Names
EDEM2; C20orf31; C20orf49; bA4204.1
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
EDEM2; Polyclonal Antibody; EDEM2 Antibody - N-terminal region; anti-EDEM2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GLLCALLPQHHGAPGPDGSAPDPAHYRERVKAMFYHAYDSYLENAFPFDE
Sequence Length
541
Applicable Applications for anti-EDEM2 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human EDEM2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: EDEM2Sample Tissue: Human HCT116 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: EDEM2Sample Tissue: Human HCT116 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-EDEM2 antibody
In the endoplasmic reticulum (ER), misfolded proteins are retrotranslocated to the cytosol and degraded by the proteasome in a process known as ER-associated degradation (ERAD). EDEM2 belongs to a family of proteins involved in ERAD of glycoproteins.
Product Categories/Family for anti-EDEM2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
59 kDa
NCBI Official Full Name
ER degradation-enhancing alpha-mannosidase-like protein 2 isoform 2
NCBI Official Synonym Full Names
ER degradation enhancing alpha-mannosidase like protein 2
NCBI Official Symbol
EDEM2
NCBI Official Synonym Symbols
C20orf31; C20orf49; bA4204.1
NCBI Protein Information
ER degradation-enhancing alpha-mannosidase-like protein 2
UniProt Protein Name
ER degradation-enhancing alpha-mannosidase-like protein 2
UniProt Gene Name
EDEM2
UniProt Synonym Gene Names
C20orf31; C20orf49
UniProt Entry Name
EDEM2_HUMAN

NCBI Description

In the endoplasmic reticulum (ER), misfolded proteins are retrotranslocated to the cytosol and degraded by the proteasome in a process known as ER-associated degradation (ERAD). EDEM2 belongs to a family of proteins involved in ERAD of glycoproteins (Mast et al., 2005 [PubMed 15537790]).[supplied by OMIM, Mar 2008]

Uniprot Description

EDEM2: Involved in endoplasmic reticulum-associated degradation (ERAD) that targets misfolded glycoproteins for degradation in an N-glycan-dependent manner. It lacks mannosidase activity. Extracts misfolded glycoproteins, but not glycoproteins undergoing productive folding, from the calnexin cycle. Belongs to the glycosyl hydrolase 47 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 20q11.22

Cellular Component: endoplasmic reticulum membrane; endoplasmic reticulum lumen; extracellular region

Molecular Function: mannosyl-oligosaccharide 1,2-alpha-mannosidase activity; calcium ion binding

Biological Process: cellular protein metabolic process; protein folding; protein amino acid N-linked glycosylation via asparagine; post-translational protein modification; response to unfolded protein

Research Articles on EDEM2

Similar Products

Product Notes

The EDEM2 edem2 (Catalog #AAA3221987) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The EDEM2 Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's EDEM2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the EDEM2 edem2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GLLCALLPQH HGAPGPDGSA PDPAHYRERV KAMFYHAYDS YLENAFPFDE. It is sometimes possible for the material contained within the vial of "EDEM2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.