Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-DUSP19 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Muscle)

Rabbit DUSP19 Polyclonal Antibody | anti-DUSP19 antibody

DUSP19 antibody - C-terminal region

Gene Names
DUSP19; SKRP1; DUSP17; LMWDSP3; TS-DSP1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
DUSP19; Polyclonal Antibody; DUSP19 antibody - C-terminal region; anti-DUSP19 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SEQTSFTSAFSLVKNARPSICPNSGFMEQLRTYQEGKESNKCDRIQENSS
Sequence Length
217
Applicable Applications for anti-DUSP19 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 86%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 92%; Rabbit: 79%; Rat: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human DUSP19
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-DUSP19 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Muscle)

Western Blot (WB) (WB Suggested Anti-DUSP19 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Muscle)
Related Product Information for anti-DUSP19 antibody
This is a rabbit polyclonal antibody against DUSP19. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: DUSP19 belongs to the protein-tyrosine phosphatase family, non-receptor class dual specificity subfamily. It contains 1 tyrosine-protein phosphatase domain. DUSP19 has a dual specificity toward Ser/Thr and Tyr-containing proteins.
Product Categories/Family for anti-DUSP19 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24kDa
NCBI Official Full Name
dual specificity protein phosphatase 19 isoform 1
NCBI Official Synonym Full Names
dual specificity phosphatase 19
NCBI Official Symbol
DUSP19
NCBI Official Synonym Symbols
SKRP1; DUSP17; LMWDSP3; TS-DSP1
NCBI Protein Information
dual specificity protein phosphatase 19
UniProt Protein Name
Dual specificity protein phosphatase 19
UniProt Gene Name
DUSP19
UniProt Synonym Gene Names
DUSP17; LMWDSP3; SKRP1; LMW-DSP3
UniProt Entry Name
DUS19_HUMAN

NCBI Description

Dual-specificity phosphatases (DUSPs) constitute a large heterogeneous subgroup of the type I cysteine-based protein-tyrosine phosphatase superfamily. DUSPs are characterized by their ability to dephosphorylate both tyrosine and serine/threonine residues. They have been implicated as major modulators of critical signaling pathways. DUSP19 contains a variation of the consensus DUSP C-terminal catalytic domain, with the last serine residue replaced by alanine, and lacks the N-terminal CH2 domain found in the MKP (mitogen-activated protein kinase phosphatase) class of DUSPs (see MIM 600714) (summary by Patterson et al., 2009 [PubMed 19228121]).[supplied by OMIM, Dec 2009]

Uniprot Description

DUSP19: Has a dual specificity toward Ser/Thr and Tyr-containing proteins. Belongs to the protein-tyrosine phosphatase family. Non-receptor class dual specificity subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Protein phosphatase, dual-specificity; EC 3.1.3.48; EC 3.1.3.16; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 2q32.1

Cellular Component: cytoplasm

Molecular Function: protein tyrosine/threonine phosphatase activity; JUN kinase phosphatase activity; MAP-kinase scaffold activity; protein kinase inhibitor activity; protein tyrosine phosphatase activity; mitogen-activated protein kinase kinase kinase binding; protein kinase activator activity

Biological Process: positive regulation of JNK activity; negative regulation of JNK cascade; negative regulation of JNK activity; positive regulation of MAPKKK cascade; positive regulation of protein kinase activity; JNK cascade; negative regulation of protein kinase activity; positive regulation of JNK cascade; protein amino acid dephosphorylation; inactivation of MAPK activity

Research Articles on DUSP19

Similar Products

Product Notes

The DUSP19 dusp19 (Catalog #AAA3210835) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DUSP19 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's DUSP19 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the DUSP19 dusp19 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SEQTSFTSAF SLVKNARPSI CPNSGFMEQL RTYQEGKESN KCDRIQENSS. It is sometimes possible for the material contained within the vial of "DUSP19, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.