Mouse anti-Human WBP2NL Polyclonal Antibody | anti-WBP2NL antibody

WBP2NL (WW Domain-binding Protein 2-like, Postacrosomal Sheath WW Domain-binding Protein, PAWP)

Cat. Num. AAA6000935

• Gene Names: WBP2NL; PAWP
• Reactivity: Human
• Applications: Western Blot
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: WBP2NL; Polyclonal Antibody; WBP2NL (WW Domain-binding Protein 2-like; Postacrosomal Sheath WW Domain-binding Protein; PAWP); Anti -WBP2NL (WW Domain-binding Protein 2-like; anti-WBP2NL antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human WBP2NL.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MAVNQSHTENRRGALIPNGESLLKRSPNVELSFPQRSEGSNVFSGRKTGTLFLTSYRVIFITSCSISDPMLSFMMPFDLMTNLTVEQPVFAANFIKGTIQAAPYGGWEGQATFKLVFRNGGAIEFAQLMVKAASAAARGFPLRTLNDWFSSMGIYVITGEGNMCTPQMPCSVIVYGAPPAGYGAPPPGYGAPPAGYGAQPVGNEGPPVGYRASPVRYGAPPLGYGAPPAGYGAPPLGYGAPPLGYGTPPLGYGAPPLGYGAPPAGNEGPPAGYRASPAGSGARPHESTAAQAPENEASLPSASSSQVHS

• Applicable Applications for anti-WBP2NL antibody: Western Blot (WB)
• Application Notes: Suitable for use in Western Blot.
• Immunogen: Full length human WBP2NL, aa1-310 (AAH22546).
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of WBP2NL expression in transfected 293T cell line by WBP2NL polyclonal antibody. Lane 1: CTA-250D10.11 transfected lysate (34.1kD). Lane 2: Non-transfected lysate.)

Product Categories/Family for anti-WBP2NL antibody

Antibodies; Abs to Binding Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 18490711
• NCBI GeneID: 164684
• UniProt Accession #: Q6ICG8; Q8TBF0; Q8TBF3; A3KFF7; A8MSG5; B3KXX4
• Molecular Weight: 31,909 Da
• NCBI Official Full Name: WBP2NL protein
• NCBI Official Synonym Full Names: WBP2 N-terminal like
• NCBI Official Symbol: WBP2NL
• NCBI Official Synonym Symbols: PAWP
• NCBI Protein Information: postacrosomal sheath WW domain-binding protein; WW domain-binding protein 2-like
• UniProt Protein Name: Postacrosomal sheath WW domain-binding protein
• Protein Family: Postacrosomal sheath WW domain-binding protein
• UniProt Gene Name: WBP2NL
• UniProt Synonym Gene Names: PAWP
• UniProt Entry Name: WBP2L_HUMAN

NCBI Description

WBP2NL is a sperm-specific WW domain-binding protein that promotes meiotic resumption and pronuclear development during oocyte fertilization (Wu et al., 2007 [PubMed 17289678]).[supplied by OMIM, Mar 2008]

Uniprot Description

WBP2NL: May play a role in meotic resumption and pronuclear formation, mediated by a WW domain-signaling pathway during fertilization.

Chromosomal Location of Human Ortholog: 22q13.2

Molecular Function: WW domain binding

Biological Process: meiotic cell cycle; male pronucleus formation; egg activation