Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: DNASE1L1Sample Tissue: Human Du145 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human DNASE1L1 Polyclonal Antibody | anti-DNASE1L1 antibody

DNASE1L1 Antibody - middle region

Gene Names
DNASE1L1; XIB; G4.8; DNL1L; DNASEX; DNAS1L1
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
DNASE1L1; Polyclonal Antibody; DNASE1L1 Antibody - middle region; anti-DNASE1L1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QEVVDSSGSAIPLLLRELNRFDGSGPYSTLSSPQLGRSTYMETYVYFYRS
Sequence Length
302
Applicable Applications for anti-DNASE1L1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human DNASE1L1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: DNASE1L1Sample Tissue: Human Du145 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: DNASE1L1Sample Tissue: Human Du145 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-DNASE1L1 antibody
This gene encodes a deoxyribonuclease protein that shows high sequence similarity to DNase I. The encoded protein is localized to the endoplasmic reticulum and modified by N-linked glycosylation. Alternate transcriptional splice variants encoding the same protein have been observed.
Product Categories/Family for anti-DNASE1L1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34 kDa
NCBI Official Full Name
deoxyribonuclease-1-like 1
NCBI Official Synonym Full Names
deoxyribonuclease 1 like 1
NCBI Official Symbol
DNASE1L1
NCBI Official Synonym Symbols
XIB; G4.8; DNL1L; DNASEX; DNAS1L1
NCBI Protein Information
deoxyribonuclease-1-like 1
UniProt Protein Name
Deoxyribonuclease-1-like 1
Protein Family
UniProt Gene Name
DNASE1L1
UniProt Synonym Gene Names
DNAS1L1; DNL1L; DNase I-like 1
UniProt Entry Name
DNSL1_HUMAN

NCBI Description

This gene encodes a deoxyribonuclease protein that shows high sequence similarity to DNase I. The encoded protein is localized to the endoplasmic reticulum and modified by N-linked glycosylation. Alternate transcriptional splice variants encoding the same protein have been observed. [provided by RefSeq, Jan 2015]

Uniprot Description

DNASE1L1: a member of the deoxyribonuclease family and the protein shows high sequence similarity to lysosomal DNase I. Alternate transcriptional splice variants, encoding the same protein, have been characterized. [provided by RefSeq, Jul 2008]

Protein type: EC 3.1.21.-; Deoxyribonuclease

Chromosomal Location of Human Ortholog: Xq28

Cellular Component: endoplasmic reticulum; nucleus

Molecular Function: endodeoxyribonuclease activity, producing 5'-phosphomonoesters; DNA binding; deoxyribonuclease activity; endodeoxyribonuclease activity

Biological Process: DNA metabolic process; DNA catabolic process, endonucleolytic

Research Articles on DNASE1L1

Similar Products

Product Notes

The DNASE1L1 dnase1l1 (Catalog #AAA3222067) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DNASE1L1 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DNASE1L1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the DNASE1L1 dnase1l1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QEVVDSSGSA IPLLLRELNR FDGSGPYSTL SSPQLGRSTY METYVYFYRS. It is sometimes possible for the material contained within the vial of "DNASE1L1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.