Mouse anti-Human PKD2 Monoclonal Antibody | anti-PKD2 antibody

PKD2 (Polycystin-2, Autosomal Dominant Polycystic Kidney Disease Type II Protein, Polycystic Kidney Disease 2 Protein, Polycystwin, R48321) (Biotin)

Cat. Num. AAA6143584

• Gene Names: PKD2; PC2; PKD4; Pc-2; APKD2; TRPP2
• Reactivity: Human
• Applications: ELISA, Immunofluorescence, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: PKD2; Monoclonal Antibody; PKD2 (Polycystin-2; Autosomal Dominant Polycystic Kidney Disease Type II Protein; Polycystic Kidney Disease 2 Protein; Polycystwin; R48321) (Biotin); anti-PKD2 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 4C8
• Specificity: Recognizes human PKD2.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-PKD2 antibody: ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
• Application Notes: IF: 10ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa261-361 from human PKD2 (NP_000288) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: PVSKTEKTNFKTLSSMEDFWKFTEGSLLDGLYWKMQPSNQTEADNRSFIFYENLLLGVPRIRQLRVRNGSCSIPQDLRDEIKECYDVYSVSSEDRAPFGP
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB)

(PKD2 monoclonal antibody. Western Blot analysis of PKD2 expression in human liver.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to PKD2 on HeLa cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged PKD2 is ~0.3ng/ml as a capture antibody.)

Product Categories/Family for anti-PKD2 antibody

Antibodies; Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 4505835
• NCBI GeneID: 5311
• NCBI Accession #: NP_000288
• NCBI GenBank Nucleotide #: NM_000297
• UniProt Accession #: Q13563; O60441; Q15764; Q2M1Q3; Q2M1Q5
• Molecular Weight: 98,838 Da
• NCBI Official Full Name: polycystin-2
• NCBI Official Synonym Full Names: polycystic kidney disease 2 (autosomal dominant)
• NCBI Official Symbol: PKD2
• NCBI Official Synonym Symbols: PC2; PKD4; Pc-2; APKD2; TRPP2
• NCBI Protein Information: polycystin-2; R48321; autosomal dominant polycystic kidney disease type II protein; polycystwin; transient receptor potential cation channel, subfamily P, member 2
• UniProt Protein Name: Polycystin-2
• Protein Family: Polycystin
• UniProt Gene Name: PKD2
• UniProt Entry Name: PKD2_HUMAN

Uniprot Description

PKD2: Involved in fluid-flow mechanosensation by the primary cilium in renal epithelium. PKD1 and PKD2 may function through a common signaling pathway that is necessary for normal tubulogenesis. Acts as a regulator of cilium length, together with PKD1. The dynamic control of cilium length is essential in the regulation of mechanotransductive signaling. The cilium length response creates a negative feedback loop whereby fluid shear-mediated deflection of the primary cilium, which decreases intracellular cAMP, leads to cilium shortening and thus decreases flow-induced signaling. Functions as a calcium permeable cation channel. Defects in PKD2 are the cause of polycystic kidney disease autosomal dominant type 2 (ADPKD2). ADPKD2 is a disorder characterized by progressive formation and enlargement of cysts in both kidneys, typically leading to end-stage renal disease in adult life. Cysts also occurs in the liver and other organs. It represents approximately 15% of the cases of autosomal dominant polycystic kidney disease. ADPKD2 is clinically milder than ADPKD1 but it has a deleterious impact on overall life expectancy. Belongs to the polycystin family. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Channel, cation; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 4q22.1

Cellular Component: filamentous actin; endoplasmic reticulum membrane; nonmotile primary cilium; endoplasmic reticulum; integral to plasma membrane; lamellipodium; cytoplasm; basal plasma membrane; plasma membrane; motile primary cilium; intercellular junction; basal cortex; cilium

Molecular Function: voltage-gated cation channel activity; actinin binding; identical protein binding; protein homodimerization activity; phosphoprotein binding; voltage-gated ion channel activity; calcium ion binding; muscle alpha-actinin binding; ATPase binding; calcium-induced calcium release activity; voltage-gated calcium channel activity; protein binding; potassium channel activity; voltage-gated sodium channel activity; cytoskeletal protein binding; HLH domain binding; receptor binding

Biological Process: neural tube development; positive regulation of inositol-1,4,5-triphosphate receptor activity; embryonic placenta development; cytoplasmic sequestering of transcription factor; positive regulation of nitric oxide biosynthetic process; regulation of cAMP metabolic process; heart development; detection of mechanical stimulus; JAK-STAT cascade; liver development; G1/S-specific positive regulation of cyclin-dependent protein kinase activity; regulation of cell proliferation; negative regulation of cell proliferation; ureteric bud branching; spinal cord development; release of sequestered calcium ion into cytosol; calcium ion transport; positive regulation of transcription from RNA polymerase II promoter; heart looping; cell cycle arrest; determination of left/right symmetry; centrosome duplication

Disease: Polycystic Kidney Disease 2