Western Blot (WB)
(Western blot analysis of extracts of HepG2 cells, using DHX29 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)
Rabbit anti-Human DHX29 Polyclonal Antibody | anti-DHX29 antibody
DHX29 Rabbit pAb
Reactivity
Human
Applications
Western Blot
Purity
Affinity purification
Synonyms
DHX29; Polyclonal Antibody; DHX29 Rabbit pAb; DDX29; anti-DHX29 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
LHIMKCNLGSPEDFLSKALDPPQLQVISNAMNLLRKIGACELNEPKLTPLGQHLAALPVNVKIGKMLIFGAIFGCLDPVATLAAVMTEKSPFTTPIGRKDEADLAKSALAMADSDHLTIYNAYLGWKKARQEGGYRSEITYCRRNFLNRTSLLTLEDVKQELIKLVKAAGFSSSTTSTSWEGNRASQTLSFQEIALLKAVLVAGLYDNVGKIIYTKSVDVTEKLACIVETAQGKAQVHPSSVNRDLQTHGWLLYQEKIRYARVYLRETTLITPFPVLLFGGDIEVQHRERLLSIDGWIYFQAPVKIAVIFKQLRVLIDSVLRKKLENPKMSLENDKILQIITELIKTENN
Applicable Applications for anti-DHX29 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1020-1369 of human DHX29 (NP_061903.2).
Positive Samples
HepG2
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
Western Blot (WB)
(Western blot analysis of extracts of HepG2 cells, using DHX29 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)
Western Blot (WB)
(Western blot analysis of extracts of HepG2 cells, using DHX29 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)
Related Product Information for anti-DHX29 antibody
Background: This gene encodes a member of the DEAH (Asp-Glu-Ala-His) subfamily of proteins, part of the DEAD (Asp-Glu-Ala-Asp) box family of RNA helicases. The encoded protein functions in translation initiation, and is specifically required for ribosomal scanning across stable mRNA secondary structures during initiation codon selection. This protein may also play a role in sensing virally derived cytosolic nucleic acids. Knockdown of this gene results in reduced protein translation and impaired proliferation of cancer cells. [provided by RefSeq, Sep 2016]
NCBI and Uniprot Product Information
NCBI GeneID
UniProt Accession #
Molecular Weight
Calculated MW: 155kDa
Observed MW: 155kDa
Observed MW: 155kDa
UniProt Protein Name
ATP-dependent RNA helicase DHX29
Protein Family
UniProt Gene Name
DHX29
UniProt Synonym Gene Names
DDX29
UniProt Entry Name
DHX29_HUMAN
Uniprot Description
DDX29: ATP-binding RNA helicase involved in translation initiation. Required for efficient initiation on mammalian mRNAs with structured 5'-UTRs by promoting efficient NTPase-dependent 48S complex formation. Specifically binds to the 40S ribosome near the mRNA entrance. Does not possess a processive helicase activity. Belongs to the DEAD box helicase family. DEAH subfamily.
Protein type: Translation; Helicase; EC 3.6.4.13
Chromosomal Location of Human Ortholog: 5q11.2
Cellular Component: mitochondrion; nucleus
Molecular Function: translation initiation factor activity; ATP-dependent RNA helicase activity; ribosomal small subunit binding; ATP binding
Biological Process: RNA processing; translational initiation
Similar Products
Product Notes
The DHX29 dhx29 (Catalog #AAA9142953) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DHX29 Rabbit pAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DHX29 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the DHX29 dhx29 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: LHIMKCNLGS PEDFLSKALD PPQLQVISNA MNLLRKIGAC ELNEPKLTPL GQHLAALPVN VKIGKMLIFG AIFGCLDPVA TLAAVMTEKS PFTTPIGRKD EADLAKSALA MADSDHLTIY NAYLGWKKAR QEGGYRSEIT YCRRNFLNRT SLLTLEDVKQ ELIKLVKAAG FSSSTTSTSW EGNRASQTLS FQEIALLKAV LVAGLYDNVG KIIYTKSVDV TEKLACIVET AQGKAQVHPS SVNRDLQTHG WLLYQEKIRY ARVYLRETTL ITPFPVLLFG GDIEVQHRER LLSIDGWIYF QAPVKIAVIF KQLRVLIDSV LRKKLENPKM SLENDKILQI ITELIKTENN. It is sometimes possible for the material contained within the vial of "DHX29, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
