Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of extracts of A-431 cells, using PI4K2B antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)

Rabbit anti-Human PI4K2B Polyclonal Antibody | anti-PI4K2B antibody

PI4K2B Rabbit pAb

Gene Names
PI4K2B; PIK42B; PI4KIIB
Reactivity
Human
Applications
Western Blot
Purity
Affinity purification
Synonyms
PI4K2B; Polyclonal Antibody; PI4K2B Rabbit pAb; PI4KIIB; PIK42B; anti-PI4K2B antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
MEDPSEPDRLASADGGSPEEEEDGEREPLLPRIAWAHPRRGAPGSAVRLLDAAGEEGEAGDEELPLPPGDVGVSRSSSAELDRSRPAVSVTIGTSEMNAFLDDPEFADIMLRAEQAIEVG
Applicable Applications for anti-PI4K2B antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human PI4K2B (NP_060793.2).
Positive Samples
A-431
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot analysis of extracts of A-431 cells, using PI4K2B antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)

Western Blot (WB) (Western blot analysis of extracts of A-431 cells, using PI4K2B antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)
Related Product Information for anti-PI4K2B antibody
Background: This gene encodes a member of the type II PI4 kinase protein family. The encoded protein is primarily cytosolic and contributes to overall PI4-kinase activity along with other protein family members. This protein is involved in early T cell activation. [provided by RefSeq, Dec 2016]

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
54,744 Da
NCBI Official Full Name
phosphatidylinositol 4-kinase type 2-beta
NCBI Official Synonym Full Names
phosphatidylinositol 4-kinase type 2 beta
NCBI Official Symbol
PI4K2B
NCBI Official Synonym Symbols
PIK42B; PI4KIIB
NCBI Protein Information
phosphatidylinositol 4-kinase type 2-beta; PI4KII-BETA; phosphatidylinositol 4-kinase type II-beta; phosphatidylinositol 4-kinase type-II beta
UniProt Protein Name
Phosphatidylinositol 4-kinase type 2-beta
UniProt Gene Name
PI4K2B
UniProt Synonym Gene Names
PI4KII-BETA
UniProt Entry Name
P4K2B_HUMAN

Similar Products

Product Notes

The PI4K2B pi4k2b (Catalog #AAA9142963) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PI4K2B Rabbit pAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PI4K2B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the PI4K2B pi4k2b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MEDPSEPDRL ASADGGSPEE EEDGEREPLL PRIAWAHPRR GAPGSAVRLL DAAGEEGEAG DEELPLPPGD VGVSRSSSAE LDRSRPAVSV TIGTSEMNAF LDDPEFADIM LRAEQAIEVG. It is sometimes possible for the material contained within the vial of "PI4K2B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.